Conserved Protein Domain Family
RabL2

?
cd04124: RabL2 
Rab GTPase-like family 2 (Rab-like2)
RabL2 (Rab-like2) subfamily. RabL2s are novel Rab proteins identified recently which display features that are distinct from other Rabs, and have been termed Rab-like. RabL2 contains RabL2a and RabL2b, two very similar Rab proteins that share > 98% sequence identity in humans. RabL2b maps to the subtelomeric region of chromosome 22q13.3 and RabL2a maps to 2q13, a region that suggests it is also a subtelomeric gene. Both genes are believed to be expressed ubiquitously, suggesting that RabL2s are the first example of duplicated genes in human proximal subtelomeric regions that are both expressed actively. Like other Rab-like proteins, RabL2s lack a prenylation site at the C-terminus. The specific functions of RabL2a and RabL2b remain unknown. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.
Statistics
?
PSSM-Id: 133324
View PSSM: cd04124
Aligned: 4 rows
Threshold Bit Score: 301.393
Threshold Setting Gi: 70834947
Created: 12-Jan-2006
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
  next features
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:
  • Comment:Based on sequence similarity with other Rab isoforms.
  • Comment:The active conformation of Rab is stabilized by interations between the gamma phosphate of GTP and two critically conserved residues, Thr in switch I and Gly in switch II

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1             #######         #     ##                          #                     
AAD51377   22 VKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTAtvd-gkTILVDFWDTAGQERFQSMHASYYHKAHACIMV 100 human
AAH77550   22 VKIICLGDSAVGKSKLMERFLMDGFRPQQLSTFALTLYKYSTcid-gnTVLVDFWDTAGQERFHSMHASYYHKAHACIMV 100 African clawed frog
CAI39357   18 LKIILLGDSAVGKSKLVERFLLDDYEERQQSTYALTMYRHNAkfe-gkTYKIDLWDTAGQECFQTLHASYYYGAHACILC 96  Paramecium tetraur...
EAN80449   20 VKVILLGDSAVGKSKLVERFLMQRYVPVQMSTYALTLFHYDFvteddeAIDVDIWDTAGQERFSTMHPAYYHEAHACILV 99  Trypanosoma brucei
Feature 1                                     ## #                       ###                  
AAD51377  101 FDIQRKVTYRNLSTWYTELREFRPEIPCIVVANKID-DINVTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVS 179 human
AAH77550  101 FDVQRKITYKNLSKWYQELREYRPEIPCIVVANKIDaDLRVTQKGFNFAKKHNLPFYFVSAADGTNVVKLFRDAIKLAVS 180 African clawed frog
CAI39357   97 FDVTRKITYTNLKKWYEEMRQNCPTIPCLLVANKIDlDPSVTETKFKFAESNNLPIYYTSSADGTNVVKVFQEALKAAIE 176 Paramecium tetraur...
EAN80449  100 FDVTRKATYKNLEKWLGELRNYREHIPCIVACNKIDtDPSVVNKAFAFVEKHNLSLFYVSAADGTNVVQLLESAISEAVK 179 Trypanosoma brucei
Feature 1       
AAD51377  180 YK 181 human
AAH77550  181 YK 182 African clawed frog
CAI39357  177 HK 178 Paramecium tetraurelia
EAN80449  180 YK 181 Trypanosoma brucei

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap