1Z0F


Conserved Protein Domain Family
Rab14

?
cd04122: Rab14 
Click on image for an interactive view with Cn3D
Rab GTPase family 14 (Rab14)
Rab14 GTPases are localized to biosynthetic compartments, including the rough ER, the Golgi complex, and the trans-Golgi network, and to endosomal compartments, including early endosomal vacuoles and associated vesicles. Rab14 is believed to function in both the biosynthetic and recycling pathways between the Golgi and endosomal compartments. Rab14 has also been identified on GLUT4 vesicles, and has been suggested to help regulate GLUT4 translocation. In addition, Rab14 is believed to play a role in the regulation of phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Statistics
?
PSSM-Id: 133322
View PSSM: cd04122
Aligned: 8 rows
Threshold Bit Score: 327.178
Threshold Setting Gi: 71661053
Created: 11-Jan-2006
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 14 residues -Click on image for an interactive view with Cn3D
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:
  • Comment:The active conformation of Rab is stabilized by interations between the gamma phosphate of GTP and two critically conserved residues, Thr in switch I and Gly in switch II
  • Structure:1Z0F: Human Rab14 binds GDP and Mg2+, defined using 3.5 A contacts
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                   ######         #                             #                       
1Z0F_A        14 YIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALM 93  human
NP_001007505  10 YIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALM 89  western clawed ...
AAH45374      10 YIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKVKLQIWDTAGQERFRAVTRSYYRGAAGALM 89  zebrafish
AAO41194      28 YIFKYIIIGDMGVGKSCLLHQFTEKKFMANCPHTIGVEFGTRIIEVDDKKIKLQIWDTAGQERFRAVTRSYYRGAAGALM 107 fruit fly
XP_640740      7 YIFKYIIIGDMGVGKSCLLHQFTENKFVPDSPHTIGVEFGTRIVDVNNKKIKLQIWDTAGQERFRAVTRSYYRGAAGALL 86  Dictyostelium d...
XP_817553      5 YIFKYIIIGDMGVGKSCLMQRFTEQRFRNDLPHTIGVEFGTITVDINGETVKLQIWDTAGQERFRSVTRGYYRGAAGALL 84  Trypanosoma cru...
NP_510572     10 YIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALM 89  nematode
AAP06100      11 YIFKYIIVGDMGVGKSCLMHQFTEKKFIPDCPHTIGVEFATKIVEVNDQKVKIQIWDTAGQERFRAVTRSYYRGAAGVLL 90  Schistosoma jap...
Feature 1                                          ## ##                          ##             
1Z0F_A        94 VYDITrRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKtGENVEDAFLEAA 173 human
NP_001007505  90 VYDITrRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKtGENVEDAFLEAA 169 western clawed ...
AAH45374      90 VYDITrRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKtGENVEDAFLEAA 169 zebrafish
AAO41194     108 VYDITrRSTYNHLSSWLTDTRNLTNPSTVIFLIGNKSDLESTREVTYEEAKEFADENGLMFLEASAMtGQNVEEAFLETA 187 fruit fly
XP_640740     87 VYDITrRITYNHLTTWLTDARNLTNPNTVIMLIGNKKDLEGQRDVTYEEASAFAKQNGLIFVESSAKtGENVEEAFLRTA 166 Dictyostelium d...
XP_817553     85 VYDVSrRETFSRIGTWLQDARGNTNPHTVMMLVGNKSDLDESREVSYEEAVKFADENNLLFVECSALnGDNVEQAFLSTA 164 Trypanosoma cru...
NP_510572     90 VYDITrRSTYNHLSSWLADAKSLTNPNTAIFLIGNKADLEDQRDVPYEEAKAFAEENGLTFLECSAKtGSNVEDAFLETA 169 nematode
AAP06100      91 VYDITrKLTFTRIQTWLTDARRLTSPDTVIFLIGNKADLDGQRDVTFEEAKLVADENDLMFLECSAKsGANVEEVFIETA 170 Schistosoma jap...
Feature 1              
1Z0F_A       174 KKIYQN 179 human
NP_001007505 170 KKIYQN 175 western clawed frog
AAH45374     170 KKIYQN 175 zebrafish
AAO41194     188 RKIYQN 193 fruit fly
XP_640740    167 KLIFQS 172 Dictyostelium discoideum AX4
XP_817553    165 HKIHEK 170 Trypanosoma cruzi strain CL Brener
NP_510572    170 KQIYQN 175 nematode
AAP06100     171 RKIFQN 176 Schistosoma japonicum

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap