Conserved Protein Domain Family
Rab40

?
cd04121: Rab40 
Rab GTPase family 40 (Rab40) contains Rab40a, Rab40b and Rab40c
The Rab40 subfamily contains Rab40a, Rab40b, and Rab40c, which are all highly homologous. In rat, Rab40c is localized to the perinuclear recycling compartment (PRC), and is distributed in a tissue-specific manor, with high expression in brain, heart, kidney, and testis, low expression in lung and liver, and no expression in spleen and skeletal muscle. Rab40c is highly expressed in differentiated oligodendrocytes but minimally expressed in oligodendrocyte progenitors, suggesting a role in the vesicular transport of myelin components. Unlike most other Ras-superfamily proteins, Rab40c was shown to have a much lower affinity for GTP, and an affinity for GDP that is lower than for GTP. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Statistics
?
PSSM-Id: 133321
View PSSM: cd04121
Aligned: 4 rows
Threshold Bit Score: 358.478
Threshold Setting Gi: 16769094
Created: 14-Nov-2005
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
  next features
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:
  • Comment:Based on sequence similarity with other Rab isoforms.
  • Comment:The active conformation of Rab is stabilized by interations between the gamma phosphate of GTP and two critically conserved residues, Thr in switch I and Gly in switch II

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                      #######         #      #                         #                
Q96S21         9 KSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYaySNGIDYKTTTILLDGRRVKLELWDTSGQGRFCTIFRSYSRGAQ 88  human
AAH78543       9 KAYDFLLKFLLVGDSDVGKGEILASLQDGSTESPYgyNMGIDYKTTTILLDGRRIKLQLWDTSGQGRFCTIFRSYSRGAQ 88  African clawed ...
AAL28766       3 KDYDYLLKVLLVGDSDVGKHEILSNLEDPSTESPF--CSGNAYKTTTILLEGKRVKLQLWDTSGQGRFCTIIRSYSRGAQ 80  fruit fly
NP_001002524  17 KAYDFLLKFLLVGDSDVGKGEILASLQDGSSESPYgyNMGIDYKTTTILLDGRRVKLQLWDTSGQGRFCTIFRSYSRGAQ 96  zebrafish
Feature 1                                             ## #                          ###          
Q96S21        89 GILLVYDITNRWSFDGIDRWIKEIDEHAPGVPRILVGNRLHLAFKRQVPTEQARAYAEKNCMTFFEVSPLCNFNVIESFT 168 human
AAH78543      89 GVILVYDITNRWSFDGIDRWIKEIDEHAPGVPKILVGNRLHLAFKRQVSTDQAQNFAERLGMTFFEVSPLCNFNITESFT 168 African clawed ...
AAL28766      81 GIILVYDITNKWSFDGIDRWLKEVDEHAPGIPKVLVGNRLHLAFKRQVAAKQAETYASRNNMSCFEISPLCNFNIRESFC 160 fruit fly
NP_001002524  97 GVILVYDITNRWSFDGIDRWIKEIDEHAPGVPKILVGNRLHLAYKRQVTTEHTQAFVERLGVTFFEVSPLCNFNITESFT 176 zebrafish
Feature 1                                                                                        
Q96S21       169 ELSRIVLMRHGmekiwrpnrvfslqdlccraivsctpvhlidklplpvtikshlksfsmangmnavmmhgrsyslasgag 248 human
AAH78543     169 ELARIVLMRHGmdrlwrpnkvlslqdlccraivsctpvhlvdklplpvalrs---hlksfsmanglnarmmhgrsyslta 245 African clawed ...
AAL28766     161 ELARMALHRNGmehiwrsnkvlslqelccrtivrrtsvyaids---------------------lplppsvkstlksyal 219 fruit fly
NP_001002524 177 ELARIVLMRHGmerlwrpnkvlslqdlccrsivsctpvhlvdklplpvalks--hlksfsmanglvntrmmhgrsysvip 254 zebrafish
Feature 1                                         
Q96S21       249 gggskgnslkrsksiRPPQSPPQNCSRSNCKIS 281 human
AAH78543     246 nntnkrnslkkakiiRPPQSPPKNCTRNSCKIS 278 African clawed frog
AAL28766     220 ttsqcfnsltqssksKNRCKTPTSSSRNSCAIA 252 fruit fly
NP_001002524 255 ssakkrngtkkskiiYPPLSPSQHCARTSCKIS 287 zebrafish

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap