Conserved Protein Domain Family
Rab35

?
cd04110: Rab35 
Rab GTPase family 35 (Rab35)
Rab35 is one of several Rab proteins to be found to participate in the regulation of osteoclast cells in rats. In addition, Rab35 has been identified as a protein that interacts with nucleophosmin-anaplastic lymphoma kinase (NPM-ALK) in human cells. Overexpression of NPM-ALK is a key oncogenic event in some anaplastic large-cell lymphomas; since Rab35 interacts with N|PM-ALK, it may provide a target for cancer treatments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Statistics
?
PSSM-Id: 133310
View PSSM: cd04110
Aligned: 6 rows
Threshold Bit Score: 370.724
Threshold Setting Gi: 45934561
Created: 9-Aug-2005
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
  next features
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:
  • Comment:Based on sequence similarity with other Rab isoforms.
  • Comment:The active conformation of Rab is stabilized by interations between the gamma phosphate of GTP and two critically conserved residues, Thr in switch I and Gly in switch II

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                      #######         #     ##                         #                
AAH57747       3 RDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTH 82  African clawed ...
Q15286         3 RDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTH 82  human
NP_608373      3 RGFDHLFKLLIIGDSGVGKSSLLIRFSDDTFSGSYITTIGVDFKIRTVDIEGMRVKLQIWDTAGQERFRTITSTYYRGTH 82  fruit fly
CAB57899       5 RDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSENYITTIGVDFKIRTMDINGQRVKLQIWDTAGQERFRTITSTYYRGTH 84  nematode
AAS79340       3 REYDHLFKLLIIGDSGVGKSSLLIRFSDNTFSGSYITTIGVDFKIRTVVINGERVKLQIWDTAGQERFRTITNTYYRGTH 82  yellow fever mo...
NP_001025840   3 RDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTH 82  chicken
Feature 1                                             ## #                           ###         
AAH57747      83 GVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPDRKVVETEDAYKFAAQMd-iRLFETSAKDNLNVEEMF 161 African clawed ...
Q15286        83 GVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMg-iQLFETSAKENVNVEEMF 161 human
NP_608373     83 GVIVVYDVTNGESFANVRRWLEEIQNNCDVVKKVLVGNKNDDPDRKVVITEDAQRFAKQMd-iELFETSAKDNINVENMF 161 fruit fly
CAB57899      85 GVVVVYDVTNGESFGNVKRWLQEIENNCDSVQKVLVGNKCEENERRVVLESDARNYAQSMn-iSFFETSAKEDKNVEPMF 163 nematode
AAS79340      83 GVIVVYDVTNGESFANVKRWLQEIEANCDVVNKVLVGNKNDDPAREGCDHRRRATFCEPDgiySFSKPQPKTNINVEENV 162 yellow fever mo...
NP_001025840  83 GVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMe-iQLFETSAKENINVEEMF 161 chicken
Feature 1                                                          
AAH57747     162 NCITELVLRAKKDNLAKQqqq-----qqnDVVKLNKNs-----KRKKRCC 201 African clawed frog
Q15286       162 NCITELVLRAKKDNLAKQqqq-----qqnDVVKLTKNs-----KRKKRCC 201 human
NP_608373    162 LSITRQVLDHKLRTSPNEqqk-----dtlHLKPNPKGs-----KGGKCCR 201 fruit fly
CAB57899     164 TCITSLVLTAKLANPQSAskd-----qsrTGGVSLKDnsgstnQKKKCKC 208 nematode
AAS79340     163 SSHPPKQVLRHKKQTPKNrvqsgskanehRSNLAPKG------ASQKKKK 206 yellow fever mosquito
NP_001025840 162 NCITELVLRAKKENLAKQqqq-----qqnDVVKLTKNs-----KRKKRCC 201 chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap