2BMJ,2IWR,3IHW


Conserved Protein Domain Family
Centaurin_gamma

?
cd04103: Centaurin_gamma 
Click on image for an interactive view with Cn3D
Centaurin gamma (CENTG) GTPase
The centaurins (alpha, beta, gamma, and delta) are large, multi-domain proteins that all contain an ArfGAP domain and ankyrin repeats, and in some cases, numerous additional domains. Centaurin gamma contains an additional GTPase domain near its N-terminus. The specific function of this GTPase domain has not been well characterized, but centaurin gamma 2 (CENTG2) may play a role in the development of autism. Centaurin gamma 1 is also called PIKE (phosphatidyl inositol (PI) 3-kinase enhancer) and centaurin gamma 2 is also known as AGAP (ArfGAP protein with a GTPase-like domain, ankyrin repeats and a Pleckstrin homology domain) or GGAP. Three isoforms of PIKE have been identified. PIKE-S (short) and PIKE-L (long) are brain-specific isoforms, with PIKE-S restricted to the nucleus and PIKE-L found in multiple cellular compartments. A third isoform, PIKE-A was identified in human glioblastoma brain cancers and has been found in various tissues. GGAP has been shown to have high GTPase activity due to a direct intramolecular interaction between the N-terminal GTPase domain and the C-terminal ArfGAP domain. In human tissue, AGAP mRNA was detected in skeletal muscle, kidney, placenta, brain, heart, colon, and lung. Reduced expression levels were also observed in the spleen, liver, and small intestine.
Statistics
?
PSSM-Id: 133303
View PSSM: cd04103
Aligned: 8 rows
Threshold Bit Score: 282.845
Threshold Setting Gi: 112491443
Created: 13-Oct-2005
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 14 residues -Click on image for an interactive view with Cn3D
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1              #######                                     #  #                        
2BMJ_A       8 LRLGVLGDARSGKSSLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLIREEAGA-PDAKFSGWADAVIFVFSLEDEN 86   human
Q9NGC3     143 LRLGIVGSLNSGKSALVHRYLTGSYMQEESPEGGRFKKEVFIDGQSYLLLIRDEGGA-PEMQFAGWVDAVIFVFSLENEG 221  fruit fly
CAA21027    79 MKLGIVGTSQSGKTALVHRYLTGTYTPDESPEGGRFKKEVVIEGQSHLLLIRDEGQQhLDVQFCQWVDAVVFVFNVCSIQ 158  Caenorhabditis e...
AAH70738    72 LKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGP-PEAQFAMWVDAVIFVFSLEDEI 150  African clawed frog
CAG11751   385 LHLGVLGGRCSGKSALVHRHLTGSYLQLENTEGRQYFKDVLVDGQSHLLIIREETEL-PGAQFASWVDAVILVFSLENEA 463  Tetraodon nigrov...
CAF90052   417 LFQGILGNLKSGKSALVNKYITGSYVALEKPDGGRYKKEVLVDGQSHLLLIREESGS-PDAQFCSWVDAVILVFSLENEA 495  Tetraodon nigrov...
2IWR_A       8 LRLGVLGDARSGKSSLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLIREEAGA-PDAKFSGWADAVIFVFSLEDEN 86   human
3IHW_A      21 LKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGP-PELQFAAWVDAVVFVFSLEDEI 99   human
Feature 1                                   ## #                             ##                
2BMJ_A      87 SFQAVSRLHGQLSSlrgegrgGLALALVGTQDRISASSPRVVGDARARALCADMKRCSYYETCATYGLNVDRVFQEVAQK 166  human
Q9NGC3     222 SFNTVYNYYTKMAHfrn--gqEIPMILVGTQDAISERNPRVIDDTRARKLASDLKRCSYYETCATYGLNVERVFQDACQK 299  fruit fly
CAA21027   159 SYDSIQALAHEMSKyrn--isDLPLILVGTKDHISEKRARVITEDEGRQLAAQMKRCSYFETSSTYGTNVERVFKEACCK 236  Caenorhabditis e...
AAH70738   151 SFQTVYHYYSRLANyrn--tsEIPMVLVGTQDAISGSNPRVIDDSRARKLSNDLKRCTYYETCATYGLNVERVFQDVAQK 228  African clawed frog
CAG11751   464 SFQEVYKLYHQLAVhrp--iaEIPFVVVGTQDKISSTNPRVIDDARARQLCSDVRRCTYYETCATYGLNVNRVFNDAAQK 541  Tetraodon nigrov...
CAF90052   496 SFQDLYQLYSQLSSqr----aDIPVIVVGTQDKISSGNPRVIEDQRARQLCIDVRNSLFYETCATYGFNVDRVFSEAAQK 571  Tetraodon nigrov...
2IWR_A      87 SFQAVSRLHGQLSSlrgegrgGLALALVGTQDRISASSPRVVGDARARALXADMKRCSYYETXATYGLNVDRVFQEVAQK 166  human
3IHW_A     100 SFQTVYNYFLRLCSfrn--asEVPMVLVGTQDAISAANPRVIDDSRARKLSTDLKRCTYYETCATYGLNVERVFQDVAQK 177  human
Feature 1       
2BMJ_A     167 V 167  human
Q9NGC3     300 I 300  fruit fly
CAA21027   237 I 237  Caenorhabditis elegans
AAH70738   229 I 229  African clawed frog
CAG11751   542 I 542  Tetraodon nigroviridis
CAF90052   572 I 572  Tetraodon nigroviridis
2IWR_A     167 V 167  human
3IHW_A     178 V 178  human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap