Conserved Protein Domain Family
C2A_Rasal1_RasA4

?
cd04054: C2A_Rasal1_RasA4 
C2 domain first repeat present in RasA1 and RasA4
Rasal1 and RasA4 are both members of GAP1 (GTPase activating protein 1). Rasal1 responds to repetitive Ca2+ signals by associating with the plasma membrane and deactivating Ras. RasA4 suppresses Ras function by enhancing the GTPase activity of Ras proteins resulting in the inactive GDP-bound form of Ras. In this way it can control cellular proliferation and differentiation. Both of these proteins contains two C2 domains, a Ras-GAP domain, a plextrin homology (PH)-like domain, and a Bruton's Tyrosine Kinase (BTK) zinc binding domain. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. This cd contains the first C2 repeat, C2A, and has a type-I topology.
Statistics
?
PSSM-Id: 176018
View PSSM: cd04054
Aligned: 4 rows
Threshold Bit Score: 239.725
Threshold Setting Gi: 86129596
Created: 19-May-2006
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Ca2+ binding
Feature 1:Ca2+ binding pocket [ion binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                       #     #                                              # #     #   
AAK31582       6 SLYIRIVEGKNLPAKDitgsSDPYCIVKVDNEPIIRTATVWKTLCPFWGEEYQVHLPPTFHAVAFYVMDEDALSRDDVIG 85  human
AAH80934       6 ALYFRLVEGKNLPAKDvsgtSDPYCIVKVDNEVVARTATVWRDLNPFWGEEFTLHLPLGFHTLSFYVMDEDTIGHDDVIG 85  western clawed ...
NP_001092921   6 TLFIRIVEGKNLPIKDitgsSDPYCIVKIDNEAIIRTATIWKTLSPFWGEEYTVHLPPYFRTVSFYVLDEDSLSRDDVIG 85  zebrafish
NP_001034423   6 SLYCRLVEGKELPAKDisgsSDPYCVVKVDNEVVARTATVWRSLNPFWGEEFTLRLPGGFHSLTIYVLDEDTIGHDDVIG 85  chicken
Feature 1                                                 
AAK31582      86 KVCLTRDTIASHPKGFSGWAHLTEVDPDEEVQGEIHLRLEV 126 human
AAH80934      86 KISLTKEFIASHPRGIDSWVNLGRVDPDEEVQGEIYLELHI 126 western clawed frog
NP_001092921  86 KVSITKEVLSAKPQGVDGWMNLTEIDPDEEVQGEIHLQISV 126 zebrafish
NP_001034423  86 KVSLSRQQISAQPRGIDSWLSLAPVHPDQEVQGEIHLEVRM 126 chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap