Conserved Protein Domain Family
CLECT_DGCR2_like

?
cd03599: CLECT_DGCR2_like 
C-type lectin-like domain (CTLD) of the type found in DGCR2, an integral membrane protein deleted in DiGeorge Syndrome (DGS)
CLECT_DGCR2_like: C-type lectin-like domain (CTLD) of the type found in DGCR2, an integral membrane protein deleted in DiGeorge Syndrome (DGS). CTLD refers to a domain homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins. DGS is also known velo-cardio-facial syndrome (VCFS). DGS is a genetic abnormality that results in malformations of the heart, face, and limbs and is associated with schizophrenia and depressive disorders. DGCR2 is a candidate for involvement in the pathogenesis of DGS since the DGCR2 gene lies within the minimal DGS critical region (MDGRC) of 22q11, which when deleted gives rise to DGS, and the DGCR2 gene is in close proximity to the balanced translocation breakpoint in a DGS patient having a balanced translocation.
Statistics
?
PSSM-Id: 153069
View PSSM: cd03599
Aligned: 5 rows
Threshold Bit Score: 316.088
Threshold Setting Gi: 47223668
Created: 24-Mar-2006
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
ligand binding
Feature 1:ligand binding surface [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                     
P98153    115 CPTGWHHYEGTASCYRVYLSGENYWDAAQTCQRLNGSLATFSTDQELRFVLAQEWDQPERSFGWKDQRKLWVGYQYVITG 194 human
AAH74280  115 CPSGWHHYEGTASCYKVYSSGENYWDAVQICQKVNGSLATFTTDQELKFILAQEWDVAERPFGRKDQLRLWVGYQFVITS 194 African clawed frog
XP_415217 264 CPTGWHHYEGTASCYRVYLNGENYWDAVQTCQRVNGSLATFTADQELRFILAQEWDLEEKTFVRKDQRRFWVGYQYVITN 343 chicken
XP_696141 222 CPSGWHHYEKTASCYKVYLRSENYWQAVETCQKVNGSLATFGTNEELQFILKIEVDFDENVCERKDQCKFWVGYQYVITN 301 zebrafish
CAF99277  117 CPSGWHHYEKTASCYKVYLRSENYWQAVETCQKVNGSLATFVTNEELQFILKIEVDFDDKVCDRRDQCKFWVGYQYVITN 196 Tetraodon nigrovir...
Feature 1                                           #   # #             # ####  ###      
P98153    195 RNRSLEGRWEVAFKGSSEVFLPPDPifasa--msendNVFCAQLQCFHFPTLRHHDLHSWHAESCYEKSSFLCKR 267 human
AAH74280  195 RNHSMEGHWEVAYKGSAEVFLPPVPifgt----adneNILCAQLQCFNLPSLRNLGLHSWFAENCYEKSSFLCKR 265 African clawed frog
XP_415217 344 RNHSLEGHWEVAYKGSSEVFLPPDPifgta--mseneNVLCAQLQCFHFPTLRHHGLHSWYAENCYEKSSFLCKR 416 chicken
XP_696141 302 QNHTLEGRWEVAYKGSMQVFLPPEGlealgeanptqdNVFCAQLQRFQIKSMNERGLHSWHAENCYKKFPFLCKR 376 zebrafish
CAF99277  197 QNHSLEGRWEVAYQGSMQVFLPPEGltnfgeasstqdSVFCAQLQRFQIKSMNERGLHSWHAENCYKKFPFLCKR 271 Tetraodon nigroviridis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap