Conserved Protein Domain Family
CLECT_attractin_like

?
cd03597: CLECT_attractin_like 
C-type lectin-like domain (CTLD) of the type found in human and mouse attractin (AtrN) and attractin-like protein (ALP)
CLECT_attractin_like: C-type lectin-like domain (CTLD) of the type found in human and mouse attractin (AtrN) and attractin-like protein (ALP). CTLD refers to a domain homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins. Mouse AtrN (the product of the mahogany gene) has been shown to bind Agouti protein and to function in agouti-induced pigmentation and obesity. Mutations in AtrN have also been shown to cause spongiform encephalopathy and hypomyelination in rats and hamsters. The cytoplasmic region of mouse ALP has been shown to binds to melanocortin receptor (MCR4). Signaling through MCR4 plays a role in appetite suppression. Attractin may have therapeutic potential in the treatment of obesity. Human attractin (hAtrN) has been shown to be expressed on activated T cells and released extracellularly. The circulating serum attractin induces the spreading of monocytes that become the focus of the clustering of non-proliferating T cells.
Statistics
?
PSSM-Id: 153067
View PSSM: cd03597
Aligned: 6 rows
Threshold Bit Score: 252.888
Threshold Setting Gi: 3676347
Created: 24-Mar-2006
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
ligand binding
Feature 1:ligand binding surface [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                      
NP_997186  748 CGEGWSHIGDACLRVNSSRENYDNAKLYCYNLSGNLASLTTSKEVEFVLdeiqk------ytqqkVSPWVGLRKINISYW 821  human
XP_421777  751 CGEGWSHIGDACLRINSSRESYDNAKLYCYNLSGNLASLTTSKEVEFVLdeiqk------ytlqkISPWVGLRKINISYW 824  chicken
XP_697655  386 CGDGWSNVGEVCLQINSSRESFDNAQHYCKNLEGKIASLTTAKQVDFVLeelqkh----qqkgkkLSPWVGLRKFNVSYW 461  zebrafish
AAC61902   714 CGIGWHLVGNSCLKITTAKENYDNAKLFCRNHNALLASLTTQKKVEFVLkqlrimqssqsmskltLTPWVGLRKINVSYW 793  human
XP_700461  493 CGESWHLVGNSCLKLMTAKDSYDNAKLVCRNQQAVLASLTTQKKVQFVLkemhnr-----slqvmITPWVGLRKINVSYW 567  zebrafish
CAG01262   675 CGDSWHLVGNSCLKFITANDSYDNAKLACRSHNAVLASLTTQKKVDFVLkelqtvs---rmyktaVTPWVGLRKINVSYW 751  Tetraodon nigrov...
Feature 1                             #   # #     # ####   ###      
NP_997186  822 GWEDMSPFTNTTLQWLPGEPNDSGFCAYLERAAVAGLKANPCTSMANGLVCEK 874  human
XP_421777  825 GWDDMSPFTNTTLQWLPGEPNDSGFCAYLERAEVAGLKANPCTAMADGLVCEK 877  chicken
XP_697655  462 GWEDESPFTNTSLQWLPGEPNDSGFCAYLERAQVSGLRANPCTANTDGLICEK 514  zebrafish
AAC61902   794 CWEDMSPFTNSLLQWMPSEPSDAGFCGILSEPSTRGLKAATCINPLNGSVCER 846  human
XP_700461  568 CWEDMSPFTNSTLQWLPGEPSDAGFCGYLAEPTFNGLKAATCVNSVNGSLCER 620  zebrafish
CAG01262   752 CWEDMSPFTNTSLQWLPGEPSDAGFCGYLAEPASSSLKAQSCINPVNGSLCER 804  Tetraodon nigroviridis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap