1TDQ


Conserved Protein Domain Family
CLECT_CSPGs

?
cd03588: CLECT_CSPGs 
Click on image for an interactive view with Cn3D
C-type lectin-like domain (CTLD) of the type found in chondroitin sulfate proteoglycan core proteins
CLECT_CSPGs: C-type lectin-like domain (CTLD) of the type found in chondroitin sulfate proteoglycan core proteins (CSPGs) in human and chicken aggrecan, frog brevican, and zebra fish dermacan. CTLD refers to a domain homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Xenopus brevican is expressed in the notochord and the brain during early embryogenesis. Zebra fish dermacan is expressed in dermal bones and may play a role in dermal bone development. CSPGs do contain LINK domain(s) which bind HA. These LINK domains are considered by one classification system to be a variety of CTLD, but are omitted from this hierarchical classification based on insignificant sequence similarity.
Statistics
?
PSSM-Id: 153058
View PSSM: cd03588
Aligned: 5 rows
Threshold Bit Score: 244.409
Threshold Setting Gi: 52695719
Created: 24-Mar-2006
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 5 residues -Click on image for an interactive view with Cn3D
Feature 1:carbohydrate binding site
Evidence:
  • Structure:1TDQ_B, rat aggrecan CLTD bound with the calcium ion designated Ca2, contacts at 3.5 A.
    View structure with Cn3D
  • Comment:Ca2 is the carbohydrate binding or principal Ca2+ in many CTLDs.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                      
1TDQ_B       7 CEEGWTKFQGHCYRHFPDRETWVDAERRCREQQSHLSSIVTPEEQEFVNKNAQDYQWIGLNDRTIEGDFRWSDGHSLQFE 86   Norway rat
P07898    1897 CEEGWIKFQGHCYRHFEERETWMDAESRCREHQAHLSSIITPEEQEFVNSHAQDYQWIGLSDRAVENDFRWSDGHSLQFE 1976 chicken
AAK40085   962 CLGDWDAFQGFCYKHFHARRSWEEAENFCREAGGHLTSIMTPEEQAFLSNKYNDYQWTGLNDRTIEGDFQWSDGNPLLFE 1041 African clawed frog
NP_999853 1342 CDFGWQKFQSHCYKYFTHRRTWEAAERECRLQGGHLTSVLSHEEQLFVNRLGHDYQWIGLNDKMFDNDFRWTDGHPMQFE 1421 zebrafish
P16112    2205 CEEGWNKYQGHCYRHFPDRETWVDAERRCREQQSHLSSIVTPEEQEFVNNNAQDYQWIGLNDRTIEGDFRWSDGHPMQFE 2284 human
Feature 1           # #      #             ##              
1TDQ_B      87 KWRPNQPDNFFATGEDCVVMIWHERGEWNDVPCNYQLPFTCKKG 130  Norway rat
P07898    1977 NWRPNQPDNFFFAGEDCVVMIWHEQGEWNDVPCNYHLPFTCKKG 2020 chicken
AAK40085  1042 NWAHGQPDSYFLSGENCVVMVGHNEGKWSDVPCNYHLPFVCKMG 1085 African clawed frog
NP_999853 1422 NWRDGQPDSFFSTGEDCVVMIWHESGQWNDVPCNYHLTFTCKKG 1465 zebrafish
P16112    2285 NWRPNQPDNFFAAGEDCVVMIWHEKGEWNDVPCNYHLPFTCKKG 2328 human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap