2NPO


Conserved Protein Domain Family
LbH_AT_putative

?
cd03360: LbH_AT_putative 
Click on image for an interactive view with Cn3D
Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain. The alignment contains 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity. A few members are identified as NeuD, a sialic acid (Sia) O-acetyltransferase that is required for Sia synthesis and surface polysaccharide sialylation.
Statistics
?
PSSM-Id: 100050
View PSSM: cd03360
Aligned: 176 rows
Threshold Bit Score: 137.231
Threshold Setting Gi: 114327804
Created: 19-Jul-2004
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
putative trimerputative CoA
Conserved site includes 15 residues -Click on image for an interactive view with Cn3D
Feature 1:putative trimer interface [polypeptide binding site]
Evidence:
  • Comment:Based on the trimer structures of some members of the superfamily including E. coli Maltose O-acetyltransferase, Chlamydia Trachomatis Lpxd, and E. coli serine acetyltransferase.
  • Comment:Most characterized members of the LbH superfamily form trimeric structures in their active form. However, there are a few members that form different quaternary structures such as Glucose-1-phosphate adenylyltransferase which forms a tetramer. Hence, not all members may form trimers.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
2NPO_A        11 IYGASGHGLVCEDVAKnm--gyKECIFLDDfkgmkfe----------------stlpkyDFFIAIGNn---eIRKKIYQK 69  Campylobacter j...
YP_201636     14 IIGAGEFAQIACEYFQhds-hyTVVAFSVErdfllqhtlaelpvvayeeleqryppeqyEVFVAIPAt---rLNRLRTRF 89  Xanthomonas ory...
YP_504524      6 IFGNSSFAQLVYYYLLnds-vfDIMGFTVDseyikedqfcnlpvfpyekieeqyppseyKMFIAIGYs---vVNTIRAQK 81  Methanospirillu...
ZP_01913953    9 IVGAGETALIAYEYFTvdt-dyEVVAFSVEsaylkekeqcglpvvpfeelqnsyspqevEAFVAISSt---kLNRIRKRL 84  Limnobacter sp....
YP_001309706   9 IIGDSAFAQIAYEYFTyds-dyEVVAFSVEkdylkdeemlglpvipledieklynpenhYVFVATVYkklnrLRTRLMKE 87  Clostridium bei...
EDN36730      10 IVGSGETALIAYEYFQyds-eyEIVAFSVSekylqdsslydlpivaletleekypttdyEIYVAISSg---kLNRSRTAV 85  Francisella tul...
ZP_01753600    9 LIGAGEFADIAYEYFThds-dyEVVGFAVEqeflqeeekfglpvvsleeaeatfapdeiEAHVAVTSt---kLNQVREKL 84  Roseobacter sp....
ZP_01501793    9 ILGDSAFAEVAYECFThds-dyEVVGFSVDsaylgrdqlfglpvvpfeeierffdpaevEFYAALVYs---qLNRLRTRF 84  Burkholderia ph...
YP_001231108   6 IFGNGQEAEMNYIYLThss-pyEVAAFTVDrayikedrllglpvvpfeniesiyppneyKMSLLISYr---kLNRLRAEK 81  Geobacter urani...
ABV92452       7 IFGTGDMAAVVAVYLRahapelRIVGYTLDdaycegdthdglplvpwsqletrfppdmfDLLGPLTYr---rMNTIRRDR 83  Dinoroseobacter...
Feature 1                                               # #   # #         #     # #         #    
2NPO_A        70 Iseng---fkiVNLIHKsaLISPSAIVEEnagILIMPyVVINAKAKIEKGVILNTSSVIEHECVIGEFSHVSVGAKCAGN 146 Campylobacter j...
YP_201636     90 FqdvvqrgyrcATYVSSraFVWHNAQIGAn--CFIFEgNVIQPFTRIGDNCVLWSGNHIGHRTAVRDHVFIASHAVISGY 167 Xanthomonas ory...
YP_504524     82 YhdakkkgyqlISYIGSkvNYWPDLKIGEn--CFIHEnPTIQPFVEIGNNVIINGSSYIAHDSFIKDHCYIAGSACIGGM 159 Methanospirillu...
ZP_01913953   85 YletkakgyrlASYVSPraFVWRNVEIGEn--CFVFEdNTLQPFVKLGNNIVLWSGNHIGHNTVIRDHCFLASQVVVSGY 162 Limnobacter sp....
YP_001309706  88 Ckdkg---yklASYISShaFVWKNVKIGEh--CFIFEnNVVQPFVELGNNTVLWSGNHIGHHSRFGDNCFVASHAVVSGF 162 Clostridium bei...
EDN36730      86 YnqikakgykcASYISSraFVWRNVEIGEn--CFIFEnNTLQPFVKVGNNVTLWSGNHIGHNTVIKDNCFISSHCVISGF 163 Francisella tul...
ZP_01753600   85 ValakgkgfrlANFVSPhaFVWRTAKLGEn--VFIFEnNVVQHGVSIGDGVVLWSGNHVGHQTKIGDFAFISSHVVISGY 162 Roseobacter sp....
ZP_01501793   85 FglakdkgyrpASYVSSraFVWPNAVIGEh--CFIFEdNTVQPFVKIGNNVVLWSGNHIGHHSTIEDNCFISSHAVISGF 162 Burkholderia ph...
YP_001231108  82 YdqakakgyelISYVNPkaVTWPGLVIGDn--CYIAEnSVICPFAEIGNNVFIGAGSLIGHHSVIKDHCFVAPHAVILGS 159 Geobacter urani...
ABV92452      84 YlegkargyafARFIHPd-CNIYTDQIGEn--CVILErNVLQPFSRVGNNCILWSGNHIGHHVTIGDHVFIASQVGIAGS 160 Dinoroseobacter...
Feature 1        ## #         #    # # #                          
2NPO_A       147 VKIGKNCFLGINSCVLP-NLSLADDSILGGGATLVKNQD-EKGVFVGVP 193 Campylobacter jejuni
YP_201636    168 CEIGQGSFIGVNATLSD-KVHIAANNIIGAGALVTRHTE-AERVYVGSP 214 Xanthomonas oryzae pv. oryzae KACC10331
YP_504524    160 VTIEPYCFVGMNTTIKD-HVIIRKMGIIGQGSVVNSDTD-EKGVYSGNP 206 Methanospirillum hungatei JF-1
ZP_01913953  163 CEIGENCFLGVNSTLIN-NITLGEDCFIGAGALIQKSTE-AGQLIQAPS 209 Limnobacter sp. MED105
YP_001309706 163 CNIGDNCFIGVNATIIN-NIKIGSDCIVGAGVLVLKDIE-SGKIVKGKA 209 Clostridium beijerinckii NCIMB 8052
EDN36730     164 CEIGENSFLGVNSTVEN-NVKIARDNFLGARTLIQKDTP-EKAFYQEKQ 210 Francisella tularensis subsp. novicida GA99-3549
ZP_01753600  163 CDIGRRSFVGVNASFAD-NVTVGADSFVALGAVVNKNYPdPGQILSGHY 210 Roseobacter sp. SK209-2-6
ZP_01501793  163 CTIGANTFIGVNSAIAN-NVVIGADNWLGVGVNILGNTE-PDCIFKGEQ 209 Burkholderia phymatum STM815
YP_001231108 160 ATIEPYCLIGANSTIRDgGVIVARECIIGAGVSITADTR-EKGVYINRA 207 Geobacter uraniumreducens Rf4
ABV92452     161 TVIGDACHIAGQVGITH-GLTIGAGCALVNGAFVSRDLA-PGSVVMGQS 207 Dinoroseobacter shibae DFL 12

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap