1OCX,2IC7,1KRV,1KQA


Conserved Protein Domain Family
LbH_MAT_GAT

?
cd03357: LbH_MAT_GAT 
Click on image for an interactive view with Cn3D
Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).
Statistics
?
PSSM-Id: 100047
View PSSM: cd03357
Aligned: 118 rows
Threshold Bit Score: 179.54
Threshold Setting Gi: 21218812
Created: 24-Jul-2006
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 30 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:Active galactoside acetyltransferase is trimeric, with active sites located at the interface between two LbH subunits. The trimer structure contains three active sites and each subunit contributes to two active sites via residues located on two surfaces.
  • Structure:1KRV; E. coli Galactoside Acetyltransferase trimer binds three CoA and substrate 4-nitrophenylgalactoside molecules; defined at 4A contacts.
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1           #          #                                             #           # #     
1OCX_C        12 LYRSAdet--lsRDRLRARQLIHRYNHSLAeehtlRQQILADLFGQVt--eAYIEPTFRCDYGyNIFLGNNFFANFDCVM 87  Escherichia coli
1KRV_C        14 LFTDMceg--lpEKRLRGKTLMYEFNHSHPsevekRESLIKEMFATVge-nAWVEPPVYFSYGsNIHIGRNFYANFNLTI 90  Escherichia coli
NP_938527      9 WHIPVspe--itQAMARTAELVFDYNATHPah-teELSRLRRLILSPaskdCTIRQPLTIEYGvNTTIGKDTFINYGVTI 85  Corynebacterium...
YP_001140505  12 GALDSqse-eiaNDRIRGQALLAQLNASSAgdhplRQRLCGELFGHCpa-sSWISTPFTCEFGrNIHIGEQTFFNFNVTI 89  Aeromonas salmo...
NP_812781     12 LADMSap---elQVRFEHAKKLLAIMRGLStyddgYRELLEELVPGIpe-tSVICPPFHCDHGdGIKLGEHVFVNANCTF 87  Bacteroides the...
ZP_01114837   13 PYDAHcqe--miQIRTRVKGILHRLNVTEYyt-erFHDTMRELCPNSas-dVHLEPPFYCDYGeNIVAGEGVFINFGAVI 88  Reinekea sp. ME...
ZP_01061806    6 PYDAHtpe--miALRKKTKHLLHKLNVTEYyt-enFQKTINELCPNAas-dLHLEPPFYCDYGdHIFAGEGVFINFGATI 81  Leeuwenhoekiell...
ZP_01216888   12 NYDPLape--feILRDSAFGLLQKINQCRFt---qAKPYYVKLLKHLge-nTVISTPFFCEYGvTISIGNNSFINMGATF 85  Psychromonas sp...
NP_233222     13 EHFDGasa-eieALRSQAGRLKLEINQSLDea--eRYALQRELFGHLgh-kSCVQPPFHCEFGkTIRIGDHTFINMNVVM 88  Vibrio cholerae...
NP_624591      1 MYVHTpefarhaERIVEVTDATSRLNVLPFsdsagRSELLSVVFGGPlpesVTIYPPFFTEYGlNTTFGENVFVNQGCTF 80  Streptomyces co...
Feature 1        # #         # #     # # # #       ## #            # ##    #           ##  # ##  
1OCX_C        88 LDVCPIRIGDNCMLAPGVHIYTATHPIDPVARn-SGAELGK-PVTIGNNVWIGGRAVINPGVTIGDNVVVASGAVVTKDV 165 Escherichia coli
1KRV_C        91 VDDYTVTIGDNVLIAPNVTLSVTGHPVHHELRk-NGEMYSF-PITIGNNVWIGSHVVINPGVTIGDNSVIGAGSIVTKDI 168 Escherichia coli
NP_938527     86 LDTAEVTIGSQVLIGPNCQLITVTHPVDNADMrtAGWEIAH-PIVVGKQAWLGAGVIVLPGVTIGERAVIGAGSVVTHDI 164 Corynebacterium...
YP_001140505  90 LDVGEVHIGNHVLLAPNVQIYTATHSMDYLERr-NWTAYNK-PVHIGDDCWIGGGAIICPGVTIGARSIIGAGAVVTRDI 167 Aeromonas salmo...
NP_812781     88 LDGGYITIGAHTLVGPCVQIYTPHHPMNYLERr-GSKEYAY-PVTIGEDCWIGGGAVICPGVTIGNRCVIGAGSVVTKDI 165 Bacteroides the...
ZP_01114837   89 LDGARVTIGRKTLIAPGVHIYTARHPVDVVER--REWEDCA-PVTIGEECWIGGHVTICPGVTIGDRAVVAAGSVVIRDV 165 Reinekea sp. ME...
ZP_01061806   82 LDGAKVTIGRKTLIAPGLHIYTARHPLEIKER--REWEDCA-PVSIGEECWIGGRVTICPGVTIGDRAVIGAGSLVTKDI 158 Leeuwenhoekiell...
ZP_01216888   86 LDNAPINIGNYVLIGPNAQFYTPTHPLDHQRR--RQWEINClPIVVSDDVWIGGNVCICQGVHIGARAIIAAGSVVTRDV 163 Psychromonas sp...
NP_233222     89 LDGAPITIGDHVLIGPSTQFYTASHSLDYRRRq-AWETICK-PIVIEDDVWIGGNVVINQGVTIGARSVVAANSVVNQDV 166 Vibrio cholerae...
NP_624591     81 MDKGGIRIGNRVMIAPKASLVTGGHPLPLAER--RAHLSFA-PIVVEDDVWIGTAAVITQGVTIGAGAVVAAGAVVTRDV 157 Streptomyces co...
Feature 1              #### #  
1OCX_C       166 PDNVVVGGNPARII 179 Escherichia coli
1KRV_C       169 PPNVVAAGVPCRVI 182 Escherichia coli
NP_938527    165 PDDTIAYGNPARVI 178 Corynebacterium diphtheriae NCTC 13129
YP_001140505 168 PADSVAVGNPARVI 181 Aeromonas salmonicida subsp. salmonicida A449
NP_812781    166 PDDSVAVGNPARLI 179 Bacteroides thetaiotaomicron VPI-5482
ZP_01114837  166 PADTLVGGNPARYI 179 Reinekea sp. MED297
ZP_01061806  159 PADTLAVGSPAKVV 172 Leeuwenhoekiella blandensis MED217
ZP_01216888  164 PADTLVGGSPAKFI 177 Psychromonas sp. CNPT3
NP_233222    167 PPDTLVGGTPARIL 180 Vibrio cholerae O1 biovar eltor str. N16961
NP_624591    158 PAGTVVAGVPARVI 171 Streptomyces coelicolor A3(2)

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap