1YIS


Conserved Protein Domain Family
Adenylsuccinate_lyase_2

?
cd03302: Adenylsuccinate_lyase_2 
Click on image for an interactive view with Cn3D
Adenylsuccinate lyase (ASL)_subgroup 2
This subgroup contains mainly eukaryotic proteins similar to ASL, a member of the Lyase class I family. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. ASL catalyzes two steps in the de novo purine biosynthesis: the conversion of 5-aminoimidazole-(N-succinylocarboxamide) ribotide (SAICAR) into 5-aminoimidazole-4-carboxamide ribotide (AICAR) and, the conversion of adenylsuccinate (SAMP) into adenosine monophosphate (AMP). ASL deficiency has been linked to several pathologies including psychomotor retardation with autistic features, epilepsy and muscle wasting.
Statistics
?
PSSM-Id: 176471
View PSSM: cd03302
Aligned: 19 rows
Threshold Bit Score: 599.303
Threshold Setting Gi: 15840192
Created: 12-Dec-2005
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
active sitetetramer
Conserved site includes 7 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                               #     
1YIS_A     11 LSTRYCKnspLVSILSETNKATLWRQLWIWLAEAEKELGLKQvt-qdAIDEXKSnrdv--fdwpFIRSEErklkHDVXAH 87  nematode
CAG36657   27 LVSRYTSp-eMQYLFSAEKKFTTWRKCWVALAEAQYELGLTDivtpeMIAELKAnvnn--idydIAAQKEkeirHDVMAH 103 Desulfotalea psych...
NP_562584   9 LNSRYASk-eMSYIFSDDMKFSTWRKLWVALAEGEKELGLNItd--eQIEELKShisd--inyeEAIKKEkevrHDVMSH 83  Clostridium perfri...
NP_596735  11 LTARYASa-eMSHLFSREMRINTWRQLWLNLAIAEKQLGLTQit-deAIEQLKAhvkitapefeIAAKEEkrqrHDVMAH 88  Schizosaccharomyce...
NP_603272  10 LCERYSSk-eMMHNFSPDKKFSTWRKLWVALAESEKELGLDIsq--eQIDEMKKniyn--idyeLAAKKEkefrHDVMAH 84  Fusobacterium nucl...
NP_868312  20 LIERYASr-eMAFHWGPQRRFASWRKVWIALAEAEQELGIAItd--aQIEQLKSfenk--lnldAAAKYErelrHDVMAH 94  Pirellula sp. 1
XP_326042  11 LATRYASq-eMMSIFSARTRASTWRQLWVWLAEAEKELGLNIpd--eAIQQMREhvtvsdkafdVAREYEnkfrHDVMAH 87  Neurospora crassa
XP_389361  11 LTGRYCSq-eLSHLFSQRSRHSTWRKLWLYLAESEKELGIPTit-deALEQMRAnlvvtdddfeTARVEEkirrHDVMAH 88  Gibberella zeae PH-1
EAL93488   12 LNSRYASn-eMKYLFSPRNRFSTWRQLWLWLAESQKELGLPIpd--eAIEQMKAhltiqddefkVAAEEEkrrrHDVMAH 88  Aspergillus fumiga...
AAS02078    8 LKSRYASk-kMLYIFSPKFKYTTWRKLWYNLALVQKELGIDIsk--kQLDKLSKhien--idfeIVKKYEekfqHEIMAH 82  Borrelia miyamotoi
Feature 1                     #                                                   #           
1YIS_A     88 NHAFGKLcpt-aagIIHLGATSCFVQDNADLIAYRDSIDHILKRFATVIDRLAAFSLKNkEVVTVGRTHYQTASLVTVGK 166 nematode
CAG36657  104 VYEYGLKcpt-aagIIHLGATSQFVVCNTDLIVQREGLLLAKKALLQVISNMAEFCDEHkDLATLGFTHYQPAQPTTVGK 182 Desulfotalea psych...
NP_562584  84 VYAYGLQcps-akgIIHLGATSCYVGDNTDVIIMRDALLLIKKKIVAVLNNLKRFALEYkDMPTLGFTHFQPAQLTTVGK 162 Clostridium perfri...
NP_596735  89 IYTYGLAapa-asgIIHLGATSCFVTDNADLIFLRSAMDLLIPKLVNVINRLSQWSLRYkDIPTLGFTHYQPAQLTTVGK 167 Schizosaccharomyce...
NP_603272  85 VHTFGTQapl-ampIIHLGATSAFVGDNTDLIQIKDGLQIIKTKLINVMSNLSKFALDNkSIATLGFTHFQAAQLTTVGK 163 Fusobacterium nucl...
NP_868312  95 VHAYGDQcpd-argIIHLGATSCFVTDNADLLLIREALELTAKRLAATIDQMAKFAAEHrDLPCLAFTHFQPAQPTTVGK 173 Pirellula sp. 1
XP_326042  88 VHAYGEDapa-aagHIHLGATSCYVTDNADLIFIQKALDLILPKLAKVIQNLKEFALKYkDTPTLGFTHYQPAQLITIGK 166 Neurospora crassa
XP_389361  89 VHAFGQVapa-aagIIHYGATSCFVTDNTELILMRDALDLLIPKLAKVLSNLQSFALEWkNEPTLSFTHLQPAQISTVGK 167 Gibberella zeae PH-1
EAL93488   89 VHAFGQVapa-aagIIHWGATSCYCTDNADLIFLRDGLDILIPKLAVVIDKLSAFAKQYkDLPCLGFTHGQPAQLVTVGK 167 Aspergillus fumiga...
AAS02078   83 PYAYADLvgddarkILHLGVTSAYLTDNTDLIQIKEALLIIKNNLIKFIKSLKEFSTKHkNLTTLAYTHLQKAQLTTLGK 162 Borrelia miyamotoi
Feature 1                                                                           #         
1YIS_A    167 RGVLWAQELLXAFQSLSEFRdkxrfRGIKGATGTQDSFLTLFAGDESKVEALDELVTKKANFsNRFLITGQTYsRQQDSQ 246 nematode
CAG36657  183 RNTLILQDLVMDLNYLDFLLdnikaRGAKGTVGTQATFLDLFKGDHAKVRALDELVAKKLGFsSTFDVTGQTYtRKHDMK 262 Desulfotalea psych...
NP_562584 163 RATLWMQDLVMDMENIDFLLstlklRGVKGTTGTQASFMNLFEGDEEKVKALDKIVAEKMGFkKSFGVTGQTYpRKLDSI 242 Clostridium perfri...
NP_596735 168 RATLWIQELLWDLRNFVRARndigfRGVKGTTGTQASFLALFEGDHAKVEELDKLVAKLSGFdNVYPVTGQTYdRKIDID 247 Schizosaccharomyce...
NP_603272 164 RATLWLQSLMLDLEELEFREktlrfRGVKGTTGTQASFKDLFNGYFSKVEELDILVSKKMGFdKRFAVTGQTYdRKVDSE 243 Fusobacterium nucl...
NP_868312 174 RACLWIYDLVLDLEAIEHRLetlraRSAKGTTGTQASFLELFSGDHDKVRALEKRIAEKLSFeSVYAVTGQTYpRKVDAQ 253 Pirellula sp. 1
XP_326042 167 RACQWIQELVMDLEDIETVRerlqfRGAQGTTGSQATFLELFEGDADKIVELNKILCKKAGFpSTYPISTQTYtRKVDLR 246 Neurospora crassa
XP_389361 168 RAAAWAQDLLMDLNEFERVRadlkfRGAQGTTGTQASFLEIFAGDHDKCDKLNELLCQKAGFeECYDISTQTYtRKVDCL 247 Gibberella zeae PH-1
EAL93488  168 RACLWIQDLLMDLRNLERARndlrfRGVKGTTGTQASFLQIFNGDHDKVEQLDELVTKKAGFdSAFIISSQTYsRKIDVD 247 Aspergillus fumiga...
AAS02078  163 RSSLWLQSLIFDFEELNFILsnmclRGVKGTVGNQNSFNELFSSNFEKVKNLDISLAKKMGFnKVYKVTSQIYdRKFDAS 242 Borrelia miyamotoi
Feature 1                                                 # #    #                            
1YIS_A    247 LVFSLSLLGAAAKKVCTDIRVLQAFGELLEPFEKDQIGSSAXPYKKNPXKSERCCALSRKLINAPQEALTIladQGLERT 326 nematode
CAG36657  263 LAETLAGIGSTAHKFAVDLRLLSNLKVQEEPFAKNQTGSSAMAYKRNPMRSERMTGLARKLMNLPQNFAATyanQWFERT 342 Desulfotalea psych...
NP_562584 243 ILNTLSEIAQSAYKFSNDLRLLQSMKEIEEPFEKNQIGSSAMAYKRNPMRSERMGALARYVIVDALNPAITastQWFERT 322 Clostridium perfri...
NP_596735 248 VLQPLASFGATAHKIATDIRLLANLKEVEEPFEAGQIGSSAMAYKRNPMRCERICSQARYIMNLIPNALNTasvQWFERT 327 Schizosaccharomyce...
NP_603272 244 IMNLLANIAQSAHKFTNDLRLLQHLKEVEEPFEKTQIGSSAMAYKRNPMRSERISSLAKFVIALQQSTAMVastQWFERT 323 Fusobacterium nucl...
NP_868312 254 LLDALSGIGQSLHKIATDIRLLAGRKEVEEPFEKKQIGSSAMAYKRNPMRSERICALGRFVMSLQSSPAMTaatQWMERT 333 Pirellula sp. 1
XP_326042 247 VANAVCAIGATAERIASDIRHLANLKEMEEPFEKSQIGSSAMAYKRNPMRSERIAALSRKLANLPVNFSNTfkaQWFERT 326 Neurospora crassa
XP_389361 248 VANAVTGFGTSVTKIASDLRHLATMKEVGEPREKGQIGSSAMAYKQNPMRSERIASLARVLQGKAANFQSThstQWMERS 327 Gibberella zeae PH-1
EAL93488  248 VANALGSFGSTCERIGIDIRHLAMLKEVEEPFEKDQIGSSAMAYKRNPMRSERLCSLGRHLQNLPKDALDTysaQWFERS 327 Aspergillus fumiga...
AAS02078  243 ILNFLSNLSQSAHKITNDIRFMQHLEEIEEHFEKNQIGSSAMPYKRNPIYSERVASLAKFIMSLQSSGGFIaatQWLERT 322 Borrelia miyamotoi
Feature 1                                                                                     
1YIS_A    327 LdDSAGRRxLIPDVLLTAEALLTTLQNIFEgLSVQTdNVKKIVedEIAFLGLEKAXXXLTeegvdRQQAHAVIRKtalea 406 nematode
CAG36657  343 LdDSAIRRmDIPQCFLLTDAILKLFINISSdMVVFPkQIEKHLraELPFMSTEKILMEAVekgenRQDMHELIKEhslaa 422 Desulfotalea psych...
NP_562584 323 LdDSANKRiAVAEAFLALDGVLYLYINIAEnMVVYDkVIEAHVnqELPFMATENIMMESVkkggdRQELHERIRVhsmda 402 Clostridium perfri...
NP_596735 328 LdDSSNRRsLLPEAFLFTDSVLKILLNVISgMVIYPkVIQKHIraELPFMATENIIMAMTkhgasRHECHEQIRVlshqa 407 Schizosaccharomyce...
NP_603272 324 LdDSANKRlSLPQAFLAVDAILIIWNNIMEgLVVYDkIIEKHImsELPFMATEYIIMECVktggdRQELHERIRVhsmea 403 Fusobacterium nucl...
NP_868312 334 LdDSANRRlVIPQAFLAIDAALVLMQNVADgMVVYPaTIAKNLgaELPFMATENILMQAVaaggdRQDLHEQIRVhsqaa 413 Pirellula sp. 1
XP_326042 327 LdDSAIRRmDIPEMFLLADSILLALDNVTNgLVVYPsVVRAHIdqELPFMATESILMKLAqhgvsRQDAHEEIRVlshqa 406 Neurospora crassa
XP_389361 328 LdDSACRRmDIPEMFLLADAIAITLQNVTEgLVVFPlKIHSNImaELPFMITENVIMRLVamgvsRQEAHEQIRVlsfea 407 Gibberella zeae PH-1
EAL93488  328 LdDSAIRRiSIPELYLSADACLILLNNVTSgFVVYPeVIRRRVndELPFMATEKIIMACVkkglsRQDAHEEIRVlshqa 407 Aspergillus fumiga...
AAS02078  323 LdDSACKRiNIPQAFLAADAILILLNKIFNnIRVNKtIIEKHVkkEIPFILTEDILMKATknggdRQILHEKIRIysmqv 402 Borrelia miyamotoi
Feature 1                                                    
1YIS_A    407 ---kqlqaTQKVDIrqtx-adpFFDSVRDRVVGLvn---npINFTGR 446 nematode
CAG36657  423 g-kvvkeeGLDNDLlnr---laEDDRIPFDLDSLlamitdyTQFTGR 465 Desulfotalea psychrophila LSv54
NP_562584 403 a-qrvkgeGLNNDLieriindpSFNLSKEEIIAIid----pVKFVGR 444 Clostridium perfringens str. 13
NP_596735 408 g-rvvkeeGGDNDLierikntpYFAPIYDELDSLld----aSTFVGR 449 Schizosaccharomyces pombe 972h-
NP_603272 404 g-kqvkveGKDNDLidrivndnYFKLDKAKLLSIle----pKNFIGF 445 Fusobacterium nucleatum subsp. nucleatum ATCC 25586
NP_868312 414 alevkqnaGDNDLLerlk-gdeNFAGIDLEAAIDp------HAYVGR 453 Pirellula sp. 1
XP_326042 407 s-avvkqeGGKNDLlerikkseFFKPVWGEIDGLvd----pALFIGN 448 Neurospora crassa
XP_389361 408 s-hqvqslGKPNDMverikktdFFKPIWADLDDMmk----pELYIGR 449 Gibberella zeae PH-1
EAL93488  408 s-dnvkklGKNNDLiervrrtaFFAPILDELDTLld----pSTFIGR 449 Aspergillus fumigatus Af293
AAS02078  403 r-enltskTTENDLiklilndeSFKLTPKDIDEVln----pNENIGF 444 Borrelia miyamotoi

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap