Conserved Protein Domain Family

cd02888: RNR_II_dimer 
Click on image for an interactive view with Cn3D
Class II ribonucleotide reductase, dimeric form
Ribonucleotide reductase (RNR) catalyzes the reductive synthesis of deoxyribonucleotides from their corresponding ribonucleotides. It provides the precursors necessary for DNA synthesis. RNRs are separated into three classes based on their metallocofactor usage. Class I RNRs, found in eukaryotes, bacteria, and bacteriophage, use a diiron-tyrosyl radical. Class II RNRs, found in bacteria, bacteriophage, algae and archaea, use coenzyme B12 (adenosylcobalamin, AdoCbl). Class III RNRs, found in anaerobic bacteria, bacteriophage, and archaea, use an FeS cluster and S-adenosylmethionine to generate a glycyl radical. Many organisms have more than one class of RNR present in their genomes. All three RNRs have a ten-stranded alpha-beta barrel domain that is structurally similar to the domain of PFL (pyruvate formate lyase). Class II RNRs are found in bacteria that can live under both aerobic and anaerobic conditions. Many, but not all members of this class are found to be homodimers. Adenosylcobalamin interacts directly with an active site cysteine to form the reactive cysteine radical.
PSSM-Id: 153089
Aligned: 31 rows
Threshold Bit Score: 372.723
Threshold Setting Gi: 14590272
Created: 7-Sep-2005
Updated: 2-Oct-2020
Aligned Rows:
Conserved site includes 20 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
  • Structure:1XJE; Class II ribonucleotide reductase from Thermotoga maritima binds GDP; contacts at 4A
    View structure with Cn3D

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1                     ##                                            #                  
1XJE_A      75 EDIFFRVLKARLFIPNSPTLFNAGlgvkhdllwkpidqm---tledyeeiyrsrnhLHMLSACFVVPVGD--------SI 143  Thermotoga maritima
AAQ59121    52 FEPLFFEALDHGFIPGGRINSAAGtd-----------------------------lRATLINCFVQPVGDsvse-tehGK 101  Chromobacterium ...
NP_623873   16 EEMFYKVMSEWKFIPGGRILAGAGtg-----------------------------rEVTYFNCFVIPVEAndpkkgndSR 66   Thermoanaerobact...
YP_114954   44 WRPLFFSALESGFIPAGRIMSAAGtg-----------------------------mQATLINCFVQPVGDsvse-etdGK 93   Methylococcus ca...
NP_629929  127 EHELAYALLHQIFSFNSPVWFNVGtp-----------------------------qPQQVSACFILSVDD--------SM 169  Streptomyces coe...
BAB06529   155 FERFYEELVNMNFVPAGRVLYGAGak-----------------------------tDVTYFNCYVMPFVKd-------SR 198  Bacillus halodur...
YP_015713  149 IEAITKELADKNIIPAGRILYGAGsk-----------------------------kEVTFFNCYVMPMIQd-------SR 192  Mycoplasma mobil...
NP_781254  126 YDEMVYALLSQMYAPNSPQWFNTGlcmeygikgspngnyyydenlkqvvesvdsysRTQASACFILSIEDkl-----lGS 200  Clostridium teta...
NP_518316   67 FARLFYVNMLHGAIGAGRIMANAGvd-----------------------------rQATMVNCFVHPIVGpga--qvaGA 115  Ralstonia solana...
AAQ66237    71 EKELFDLFDHFRYIVPQGSPMTGIgnd---------------------------fqIASLSNCFVVGLDGda-----dSY 118  Porphyromonas gi...
Feature 1                      ###                                             ## #            
Feature 1                                                                                      
1XJE_A     223 EEFIDAKKEntg-------------------------------------------------------------------- 234  Thermotoga maritima
AAQ59121   181 EDFIHAKDQg---------------------------------------------------------------------- 190  Chromobacterium ...
NP_623873  146 EEFIKVKKDlt--------------------------------------------------------------------- 156  Thermoanaerobact...
YP_114954  173 FEFVRAKDRpg--------------------------------------------------------------------- 183  Methylococcus ca...
NP_629929  249 EDFIQTKVKeeekiralrdagf----------------------------------------------------dmdlgg 276  Streptomyces coe...
BAB06529   278 LEFIISKMQnprilryllentdddqirklvkdklkftplsqleeamyqgivnyksipgmggfdakvikeaeeklriggty 357  Bacillus halodur...
YP_015713  272 VEFIISKMQkpnilkfikdkfhhplikeavnfklnfrplsqekqmn-----idailahknlmphgvvvnaenlkkaggey 346  Mycoplasma mobil...
NP_781254  280 LDFITWKAReedkvralgkmgy----------------------------------------------------dmdidg 307  Clostridium teta...
NP_518316  195 AAFVAAKRGrk--------------------------------------------------------------------- 205  Ralstonia solana...
AAQ66237   197 ESFIDAKMTeg--------------------------------------------------------------------- 207  Porphyromonas gi...
Feature 1                                                                                      
1XJE_A     235 ----eavLNFFNLSVGFPMDKKEILklyeedgelelsh----------------------------prstirkkvkireL 282  Thermotoga maritima
AAQ59121   191 ------dLRNFNISVGVSDDFMRAVeadadwqlthavepmsdafp---------------dsfrradglwvyrtvrardL 249  Chromobacterium ...
NP_623873  157 ------kMQQANLSVAVSDAFMEAVaqdkmwklefpdtshpnydaewk--------gdlnewkakgyptvvykeipareL 222  Thermoanaerobact...
YP_114954  184 ------eLTNFNLSVALNEDFMRAVetdgpwelthraepspeqqc--------------egaylredglwvyrsvpareL 243  Methylococcus ca...
NP_629929  277 dditsvqYQNANNSVRVNDTFMKAVqdggkfgltsrm------------------------------tgevieevdakaL 326  Streptomyces coe...
BAB06529   358 tvnnpdfLTGANISVCLTKEFMEAVdnddwyalrfpdvenyteeemdiynrewsnvgdvreweergfpvktyrmirakeL 437  Bacillus halodur...
YP_015713  347 eindpgfLSGANISVALTSDFMDAVknnemyelrfpdlekftkeqkafydkewhnigdvkewgklgypvkvystikakeL 426  Mycoplasma mobil...
NP_781254  308 eayetvsGQNSNNSIRFSDFFMEKVknldsmpddtieleg-------------------------rvdssvnqkvkvkdL 362  Clostridium teta...
NP_518316  206 ------rWTTFNVSVAVTDAFMQAVaddaqwrlqhraepsaqrra--------------agahlldnghwcyatvparqL 265  Ralstonia solana...
AAQ66237   208 ------kVTGANVSVKIDDEFMRAVvegkpykqqypida---------------------------kepkwekeidartL 254  Porphyromonas gi...
Feature 1                                                                                      
1XJE_A     283 FRKIATNAWKSGDPGLAFLGEMNKYyplyph------------------------------------------------- 313  Thermotoga maritima
AAQ59121   250 WRQIMESTYDHAEPGVLFMTRINQDnnlsyc------------------------------------------------- 280  Chromobacterium ...
NP_623873  223 WNKIVTAAWESAEPGVVFLERYNKLsntyyi------------------------------------------------- 253  Thermoanaerobact...
YP_114954  244 WELIMRSTYDHAEPGVLFIDRMNREnnlsycerieatnpcvtadtwvmtasgarqvrdlidrpfeavvdgechptesrgf 323  Methylococcus ca...
NP_629929  327 FRKMAEAAWACADPGIQYDDTINAWhtcpes------------------------------------------------- 357  Streptomyces coe...
BAB06529   438 WNLINICATYSAEPGIFFIDNANDMtnakay------------------------------------------------- 468  Bacillus halodur...
YP_015713  427 WDLINLCSTYSAEPGVFFIDRANELtnaqsy------------------------------------------------- 457  Mycoplasma mobil...
NP_781254  363 WDSFAKSTWMCADPAPQFSDTFNAWhtcpagedgn--------------------------------------------- 397  Clostridium teta...
NP_518316  266 WDMLVEAAHHSAEPGLLFIDTINAAndlael------------------------------------------------- 296  Ralstonia solana...
AAQ66237   255 WGKIIHNAWKSAEPGVLFWDTIIREsvpdcyad----------------------------------------------- 287  Porphyromonas gi...
Feature 1                                                                                      
1XJE_A         --------------------------------------------------------------------------------      Thermotoga maritima
AAQ59121       --------------------------------------------------------------------------------      Chromobacterium ...
NP_623873      --------------------------------------------------------------------------------      Thermoanaerobact...
YP_114954  324 fftgdkpvlrlstaeghtlrltanhpvlrvskmtrqlretewvkagelrphdkivlhdhralpswdgahteaegyligll 403  Methylococcus ca...
NP_629929      --------------------------------------------------------------------------------      Streptomyces coe...
BAB06529       --------------------------------------------------------------------------------      Bacillus halodur...
YP_015713      --------------------------------------------------------------------------------      Mycoplasma mobil...
NP_781254      --------------------------------------------------------------------------------      Clostridium teta...
NP_518316      --------------------------------------------------------------------------------      Ralstonia solana...
AAQ66237       --------------------------------------------------------------------------------      Porphyromonas gi...
Feature 1                                                                                      
1XJE_A         --------------------------------------------------------------------------------      Thermotoga maritima
AAQ59121       --------------------------------------------------------------------------------      Chromobacterium ...
NP_623873      --------------------------------------------------------------------------------      Thermoanaerobact...
YP_114954  404 igggtltrdkailsiwdaaapkvangggsvpaagvagvmraaelaartlphrtdfngwqttmegrgeyhmatgalhtlal 483  Methylococcus ca...
NP_629929      --------------------------------------------------------------------------------      Streptomyces coe...
BAB06529       --------------------------------------------------------------------------------      Bacillus halodur...
YP_015713      --------------------------------------------------------------------------------      Mycoplasma mobil...
NP_781254      --------------------------------------------------------------------------------      Clostridium teta...
NP_518316      --------------------------------------------------------------------------------      Ralstonia solana...
AAQ66237       --------------------------------------------------------------------------------      Porphyromonas gi...
Feature 1                                                                                      
1XJE_A         --------------------------------------------------------------------------------      Thermotoga maritima
AAQ59121       --------------------------------------------------------------------------------      Chromobacterium ...
NP_623873      --------------------------------------------------------------------------------      Thermoanaerobact...
YP_114954  484 elgltpgdkrltaplettssafhrgllrgmfdadgsvqgsqrkgvsirlpqtdlgnlqtvqrmllrlgvastihqnrrpg 563  Methylococcus ca...
NP_629929      --------------------------------------------------------------------------------      Streptomyces coe...
BAB06529       --------------------------------------------------------------------------------      Bacillus halodur...
YP_015713      --------------------------------------------------------------------------------      Mycoplasma mobil...
NP_781254      --------------------------------------------------------------------------------      Clostridium teta...
NP_518316      --------------------------------------------------------------------------------      Ralstonia solana...
AAQ66237       --------------------------------------------------------------------------------      Porphyromonas gi...
Feature 1                                                                                      
1XJE_A         --------------------------------------------------------------------------------      Thermotoga maritima
AAQ59121       --------------------------------------------------------------------------------      Chromobacterium ...
NP_623873      --------------------------------------------------------------------------------      Thermoanaerobact...
YP_114954  564 gtkvlpdgeggakghscqaaheliisgenvvryaerigfadsdkmdrltallqryrhtrhaerfiatvqsleddgmeavy 643  Methylococcus ca...
NP_629929      --------------------------------------------------------------------------------      Streptomyces coe...
BAB06529       --------------------------------------------------------------------------------      Bacillus halodur...
YP_015713      --------------------------------------------------------------------------------      Mycoplasma mobil...
NP_781254      --------------------------------------------------------------------------------      Clostridium teta...
NP_518316      --------------------------------------------------------------------------------      Ralstonia solana...
AAQ66237       --------------------------------------------------------------------------------      Porphyromonas gi...
Feature 1                       ### #          #                                               
1XJE_A     314 -----------rkinsTNPCGEIGLSDYEACNLGSIDVAKFynngf-------vdleALQELVQIAVRFLDNVIDVNVFP 375  Thermotoga maritima
AAQ59121   281 -----------eviesTNPCGEQPLPDYGCCDLGSVNLTRHvrapfgd--kahfdfkSFEKVVRMSVRMLDNVLDLTVWP 347  Chromobacterium ...
NP_623873  254 -----------tkiisTNPCGELGLEPYGVCNLGAINLVAFvengk-------infeELEETVKIAVRFLDNVLDLGAYV 315  Thermoanaerobact...
YP_114954  644 dvtvadvhafdanglyVHNCAEQPLPAYGCCCLGSLDLTRFvsrpftp--eaafeaeRLAEVATIAVRMLDNVLDTTYWP 721  Methylococcus ca...
NP_629929  358 -----------gringSNPCSEYMHLDNTSCNLASLNLMKFlkddgkg--nqsfdaeRFSKVVELVITAMDISICFADFP 424  Streptomyces coe...
BAB06529   469 ----------gqkvvaTNPCGEQPLAPYSVCNLAAINLAEMankqek-----tvdfkKLKQTVEVGVRMQDNVIDATPYF 533  Bacillus halodur...
YP_015713  458 ----------gqkvvcTNPCGEQPLAPYSVCNLAAINLANFvdkhtg-----kidypKLENTVKLGIRFQDNIIDKTYYF 522  Mycoplasma mobil...
NP_781254  398 ------vnakhnkinsTNPCGEYAFLDNSSCNLASINIYKFydgkek-----nidleSYLHVVGLVQLALEASIYWGQFP 466  Clostridium teta...
NP_518316  297 -----------etiaaTNPCGEQPLPAWGSCVLGPINLSRWiqhpfgvggqpmfdfvSFGRAVHIQVRMLDNAIDITRWP 365  Ralstonia solana...
AAQ66237   288 ---------lgfrtvsTNPCGEIPLCPYDSCRLLAINLYSYvknpfts--easfdfeLFRNHVVLAQRIMDDIIDLEAEK 356  Porphyromonas gi...
Feature 1                                                                                      
1XJE_A     376 i------------------------DKITKAVKEsRRLGLGIMGFADLLYKLEIpYNSQEARDFAANLMAFIALHAHRTS 431  Thermotoga maritima
AAQ59121   348 l------------------------PEQQREAMNkRRVGLGFTGLGDALIMLKIrYDSEEGRRFAARISESMRDAAYDAS 403  Chromobacterium ...
NP_623873  316 l------------------------PQNKEMAQKlRRVGLGLMGLADALILMNLrYGSEESLKATEEIVRRIRDAAYRAS 371  Thermoanaerobact...
YP_114954  722 l------------------------ARQRQEAQAkRRIGLGFTGLGDALAMLGLrYDSAAARDMAAGIARRLRDAAYLAS 777  Methylococcus ca...
NP_629929  425 t------------------------QKIGENTRAfRQLGIGYANLGALLMATGHaYDSDGGRALAGAITSLMTGTSYRRS 480  Streptomyces coe...
BAB06529   534 l------------------------EENTKQAKGeRRVGLGVMGLHDLLIYTETvYGSEEGNKLVDQIFETIATTAYRTS 589  Bacillus halodur...
YP_015713  523 l------------------------KENKDQALGeRRVGLGVMGLHDMLIWSGLkYGSKEANKVVDKVFETIATSAYLTS 578  Mycoplasma mobil...
NP_781254  467 t------------------------KDIAQKTYMfRATGLGITNLASLLMVLGYpYNSTEARNISSALVGLLTGYSYYIS 522  Clostridium teta...
NP_518316  366 l------------------------IEHMREAHAkRRIGVGVTGLADALTMMGLpYQAPEARNLAVQIGRCLRDNAYAAS 421  Ralstonia solana...
AAQ66237   357 ieqilskiasdpeseevktsernlwHKIRRKTLAgRRTGVGITAEGDMLAAMGFrYGSDEATQFAEEVQKTLALCAYSSS 436  Porphyromonas gi...
Feature 1                                                                                      
1XJE_A     432 YELGKEKGNFPlleisryrtednfvpfam--------------------------------gmsnyddeirevmkmtkeF 479  Thermotoga maritima
AAQ59121   404 VDLAIEKGAFPlfdaekylaaphca----------------------------------------srlpakiqarirkhG 443  Chromobacterium ...
NP_623873  372 VELAKEKGPFPefvadkylkgqfiq-----------------------------------------rlpkdirdeiakyG 410  Thermoanaerobact...
YP_114954  778 TALAREKGAFPlfeaepylaspfva-----------------------------------------glpeplrarilesG 816  Methylococcus ca...
NP_629929  481 AELAAIVGPYDgyarnakphlrvmkqhsdenakavrm-----------------ddldtpiwaaateawqdvlrlgeknG 543  Streptomyces coe...
BAB06529   590 IELAKEKGSFPflvgqtdeetkqlrqrfig-------------------------------tgymkkmpedirqgvleyG 638  Bacillus halodur...
YP_015713  579 IELGKEKGSFPfftsverflqsgyvk---------------------------------------klpqividafkktkA 619  Mycoplasma mobil...
NP_781254  523 SLMAKEIGTFEkfsinkphmlkvirnhakvagsinglyedlnynpvkvdhnllenigfsdlsnllkkswlkalnsgeehG 602  Clostridium teta...
NP_518316  422 AALAQERSPYPlfraerslapghfv----------------------------------------atlpgavretiarhG 461  Ralstonia solana...
AAQ66237   437 VTMAKERGAFElfdakreennpfiar--------------------------------------ireadpwlyeemkqyG 478  Porphyromonas gi...
Feature 1               ######                                                                 
1XJE_A     480 RRNVALLTIAPTGSISNIAD--TSSGLEPNFllaytrfvtkedgtkepllyvnqvlreklnpeil--------------- 542  Thermotoga maritima
AAQ59121   444 IRNSHLLSIAPTGTISLAFAdnASNGIEPPFswfytrkkrmadnsqqeylvedha------------------------- 498  Chromobacterium ...
NP_623873  411 IRNATILTQAPTGTTSILAG--VSSGIEPNFakeyvrkdrtgthtvk--------------------------------- 455  Thermoanaerobact...
YP_114954  817 IRNSHLLSIAPTGTISLAFAdnTSNGIEPPYawtylrkkrepdgstrefpvedha------------------------- 871  Methylococcus ca...
NP_629929  544 FRNSQASVIAPTGTIGLAMSc-DTTGLEPDLalvkfkklvgggsmqivngtvpqalrrlgyqeeqie------------- 609  Streptomyces coe...
BAB06529   639 IRNSHLLTVAPTGSTGTMVG--VSTGLEPYFsfsyfrsgrlgkfievkaeivqe-------------------------- 690  Bacillus halodur...
YP_015713  620 IRNSHLLTIAPTGSTGTMAG--VSTGLEPYYafkyfrsgrlgkfievdqdivae-------------------------- 671  Mycoplasma mobil...
NP_781254  603 YRNAQVSVIAPTGTISFAMDc-GATSIEPFFshvvykklsgggmmtvtnpvielslknlgyskeqikdilqyvlekevvq 681  Clostridium teta...
NP_518316  462 LRNSHLLSLAPTGSVSLAFGgnCSSGIEPAFdwayqrrvrihhgqpqlyrienha------------------------- 516  Ralstonia solana...
AAQ66237   479 RRNIACLTIAPTGSTSLMTQ--TSSGIEPVFmpvykrrrkvnpsdknvqidyvdevgdsfeefvvyhhn----------- 545  Porphyromonas gi...
Feature 1                                                                                      
1XJE_A     543 ---------kriekeliekgslkdipdvpekikkvfvvaldiDPMDHLLMQDAFQRYVDNNISKTINMPQsatvDDVLNV 613  Thermotoga maritima
AAQ59121   499 ------------------yrvwrmqggdtaklpdyfvsalemSALDHMRMVAAVAPYVDTAISKTVNVPAdypfEDFESL 560  Chromobacterium ...
NP_623873  456 ---------------------------hwladypafvsahevTPEEHVKMQAVLQKYIDSSISKTINLPRtatvDDIDNI 508  Thermoanaerobact...
YP_114954  872 -------------------yrlyratagdrplppafvtaldiSALDHMRMLAAVQPFVDASISKTVNVPAdypyADFQHL 932  Methylococcus ca...
NP_629929  610 -------aivahiaengnvidapglkpehyevfdcamgersiSAMGHVRMMAAIQPWISGALSKTVNLPEsatvEDVEEV 682  Streptomyces coe...
BAB06529   691 -------------------ylrahpeadenhlpewfistmelAPEAHADVQCIIQRWVDSSLSKTVNAPRgytvEQVQAV 751  Bacillus halodur...
YP_015713  672 -------------------wkkiknwpadkalpeifssamdlKPEEHVKVQNLIQRWIDSSISKTVNAPKgysvEDVEKV 732  Mycoplasma mobil...
NP_781254  682 tkegfkyekvldgkiegaphlkkehyaifdtankcgsgkryiEPMGHVKMVAALTPLISGAISKTVNLPNnatiEDFKKV 761  Clostridium teta...
NP_518316  517 ------------------yrcfqamhgehavlpsyfvtanqvDGDDHLKMVAALQPFIDASISKTILISGgvspAQVGAL 578  Ralstonia solana...
AAQ66237   546 ----fvtwmrtngydpdrkytneeiddlvarspyykatandvDWVAKVKMQGRIQQWVDHSISVTINLPSdvteELVNTL 621  Porphyromonas gi...
Feature 1                        
1XJE_A     614 YLEALRTNVRGITVYRDG 631  Thermotoga maritima
AAQ59121   561 YLEAWRNGLKGITTYRPN 578  Chromobacterium violaceum ATCC 12472
NP_623873  509 YRLAYELGCKGITVYRDG 526  Thermoanaerobacter tengcongensis MB4
YP_114954  933 YLEAWKAGLKGLATYRPN 950  Methylococcus capsulatus str. Bath
NP_629929  683 YFEAWKMGVKALAIYRDN 700  Streptomyces coelicolor A3(2)
BAB06529   752 YERLYRGGAKGGTVYVDG 769  Bacillus halodurans C-125
YP_015713  733 FMSLYDGGSKGGTVYVDG 750  Mycoplasma mobile 163K
NP_781254  762 ILNSWELGVKGIALYRDG 779  Clostridium tetani E88
NP_518316  579 LFRAWQLRLKGITIFRPD 596  Ralstonia solanacearum GMI1000
AAQ66237   622 YVEAWKSGCKGCTVYRDG 639  Porphyromonas gingivalis W83

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap