Conserved Protein Domain Family
RNAP_I_Rpa1_C

?
cd02735: RNAP_I_Rpa1_C 
Largest subunit (Rpa1) of Eukaryotic RNA polymerase I (RNAP I), C-terminal domain
RNA polymerase I (RNAP I) is a multi-subunit protein complex responsible for the synthesis of rRNA precursor. It consists of at least 14 different subunits, and the largest one is homologous to subunit Rpb1 of yeast RNAP II and subunit beta' of bacterial RNAP. Rpa1 is also known as Rpa190 in yeast. Structure studies suggest that different RNAP complexes share a similar crab-claw-shape structure. The C-terminal domain of Rpb1, the largest subunit of RNAP II, makes up part of the foot and jaw structures of RNAP II. The similarity between this domain and the C-terminal domain of Rpb1, its counterpart in RNAP II, suggests a similar functional and structural role.
Statistics
?
PSSM-Id: 132722
View PSSM: cd02735
Aligned: 30 rows
Threshold Bit Score: 261.743
Threshold Setting Gi: 65304964
Created: 9-Jun-2005
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
  next features
Feature 1:Rpb1 (Rpa1) - Rpb2 (Rpa2) interaction site [polypeptide binding site]
Evidence:
  • Comment:based on similarity to yeast RNAP II
  • Comment:The two largest subunits of eukaryotic RNAP I, Rpa1 and Rpa2, correspond to subunits Rpb1 and Rpb2, respectively, of yeast RNAP II.
  • Comment:The two largest subunits of yeast RNAP II, Rpb1 and Rpb2, form distinct masses with a deep cleft between them. Each of the small subunits occurs in a single copy, arrayed around the periphery.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                    #  #                                                                 
NP_191325    1146 KFFASLAQPGEPVGVLAAQSVGEPSTQMTLNTFHLAGRGEMNVTLGIPRLQEILMTAAanIKTPIMTCPLLkgktke--- 1222 thale cress
CAI73289     1392 YFERCKCDPGEAVGCIAGQSIGEPATQMTLNTFHLAGHGAANVTLGIPRLVEILQNTSh-CSTPYFSVPILgknedei-- 1468 Theileria ann...
XP_001708867 1605 KFIRSLVAPGSAVGVIAAQSTGEPSTQLTLNTFHLAGHGGVNATMGVPRLREIIMTRN--TSSPIITMSFKdkhrvsvlk 1682 Giardia lambl...
XP_001450527 1222 RYLRALMHPGEAVGCVAAQSIGEPSTQMTLNTFHLAGHGEKNVTLGIPRLREILMTATkkQKTPTMSLQFLnaniek--- 1298 Paramecium te...
XP_001014750 1255 KYLNSLIHPGDSVGCLAAQAIGEPSTQMTLNTFHLAGHGGVNLTLGIPRLREILMTATdkLKTPVMLLNLSnpevaqn-- 1332 Tetrahymena t...
EAK83798     1263 LYHRGLVDPGEAVGLLAAQGVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASqhIKTPIMRLPVLdgitad--- 1339 Ustilago mayd...
Q86H36       1128 YYSRSMVSPGESVGLLCAQSIGEPSTQMTLNTFHLAGRGEANVTLGIPRLRELIMTATtkPITPLMEFQINdstnkv--- 1204 Dictyostelium...
XP_001713248 1077 NYFENLIEPGESTGILCGQAIGEPCTQMTLNTFHYAGKISSHGKQGLPRLKEMLLYNSknSTNFLVNCRLKsiinrk--- 1153 Guillardia theta
CAD25329      953 RYICSLADPGESVGVIAAQSVGEPSTQMTLNTFHLAGVGAKNVTLGVPRLREILITASksIRTPLITVPIKrrvs----- 1027 Encephalitozo...
XP_649386    1120 KYNKSLINPGEPVGVLAGQSIGEPSTQMTLNTFHLAGRGDVNVTLGMPRIKELVMFAKkeIATPSMILYLKepnqk---- 1195 Entamoeba his...
Feature 1                                                                                         
NP_191325    1223 ------------------dandiTDRLRKITVADIIKSMELSVvpytvyenevcsihklki------nlykpehypkhtd 1278 thale cress
CAI73289     1469 ----------------aenaenaINALRKIYLSDIVQSVGMETnvyvnknsekeweysatiq-----fddfnlfrkvigh 1527 Theileria ann...
XP_001708867 1683 gdslhhktvslgpnetmrackslQQQLRKIYLRDVLRSFVLREcpisdgsvryeltmkl-----------ltlsellhef 1751 Giardia lambl...
XP_001450527 1299 -----------------sqadryAKRMSKLVFLELVNNIKVREykrltengiplhsllrgviyeidveledlnqikyvfg 1361 Paramecium te...
XP_001014750 1333 ----------------keqvqnhARKLQKINLLELVNNIEVKEqkiivvdnnilpfnerfrhyeikinledleaihfafq 1396 Tetrahymena t...
EAK83798     1340 ------------------qiktfCKDGSRLVLSQVIDEAIVTEkispksegtgfhrqktytvr---lnfypadeckeeyn 1398 Ustilago mayd...
Q86H36       1205 ------------------etekmAKYLEILKLSDIIKDITVQEyfqdtnrnydieiefiptlq---qvlslhrikekqln 1263 Dictyostelium...
XP_001713248 1154 ------------------ylekvKRNFSNYKLFDLVESIELYYnyekkrinlslkfkik-----------kkkvfvaqkl 1204 Guillardia theta
CAD25329     1028 --------------------fdiTECLRRVTLKDCVKRFGVTEeivmvsgvfqkkv-----------------kimfeld 1070 Encephalitozo...
XP_649386    1196 ------------------nteklAKLLTKVTLANIIEGIKCLDsiivhegqrrrqyt--------------idltlidky 1243 Entamoeba his...
Feature 1                                                                                         
NP_191325    1279 iteedWEETMRAVFLRKLedaiethmkmlhrirgihndvtgpiagnetdnddsvsgkqneddgdddgegtevddlgsdaq 1358 thale cress
CAI73289     1528 fdtsdIIKVCSHSLIKSFmkrvlgqmivtmdinvpfelsdktdqleefwnmfvmekqivkrdklstrirkmilssgsssd 1607 Theileria ann...
XP_001708867 1752 nfnvvVLKKLFAVAIPKHlarvltkevlahkatiqslqnklpsdtsfpeyvekvagprnstgkedsdaqedtskenssvs 1831 Giardia lambl...
XP_001450527 1362 isedqIKNKVNHVFIPLLlkiiqaelnknssrcvektsflktkeneakkqrkgsddeeeddedqqeeqddlselnqd--- 1438 Paramecium te...
XP_001014750 1397 lnidtINRRIEKVFLPNLfqyinkelkrdqkselqtrvlkkkenessgmeteglvsdfdkeaasdgeelkkaadalv--- 1473 Tetrahymena t...
EAK83798     1399 cttahILHGLQETFAPNLensinnemrkqkrehalqaaaigkgrvfsdnapagdnadedgerangvvgrsqtrsrgnead 1478 Ustilago mayd...
Q86H36       1264 klfgeFNKVIKRQVKSQGklkvnngdiglgskvrgsdlveddsltindddapanddttnndentsqqqpssqnkkskskv 1343 Dictyostelium...
XP_001713248 1205 mennnIFKCFTNQIKNFHknvminyknpfkrlfnnngdtki--------------------------------------- 1245 Guillardia theta
CAD25329     1071 nfvdlAGEVLDRKFLKLLgnkmkglakakytlgmseapkddckevdenkenegedesdsdkesdpegdn----------- 1139 Encephalitozo...
XP_649386    1244 eevvdFNTTEITKKIKSVlmneiakrqqskvgididykgvsgeeaeekvneesedvqekinkgkvieeevpee------- 1316 Entamoeba his...
Feature 1                                                                                         
NP_191325    1359 kqkkqetdemdyeens---------------------------------------------------------------- 1374 thale cress
CAI73289     1608 ipkgvggqditdtvfpsledsvcdshggdededseggtessveesevdeevgeeedeghgeeelqeeeqekeddldeeee 1687 Theileria ann...
XP_001708867 1832 nptdsepnldtdasdttdstqhaqeq------------------------------------------------------ 1857 Giardia lambl...
XP_001450527      --------------------------------------------------------------------------------      Paramecium te...
XP_001014750      --------------------------------------------------------------------------------      Tetrahymena t...
EAK83798     1479 sddeedassdagdgdaddakrkqks------------------------------------------------------- 1503 Ustilago mayd...
Q86H36       1344 itqddd-------------------------------------------------------------------------- 1349 Dictyostelium...
XP_001713248      --------------------------------------------------------------------------------      Guillardia theta
CAD25329          --------------------------------------------------------------------------------      Encephalitozo...
XP_649386         --------------------------------------------------------------------------------      Entamoeba his...
Feature 1                                                                                         
NP_191325    1375 --------------edetnepssisgvedpemdsenedtevskedtpepqeesmepqkevkgvknvkeqskkkrrkfvra 1440 thale cress
CAI73289     1688 geeefevldasqsssatvedipmdldketgdpnlmnldeqddtlsgvddfnsptlsptrmrnessgikegkqkiftinrk 1767 Theileria ann...
XP_001708867 1858 ---hdteesalhaetdpslndidqhrghealslidsninlsakakdflkewvfpdidklievaqkavnttcitlkrisft 1934 Giardia lambl...
XP_001450527 1439 ---------------------------------eevlniinqtfeqsaqqydifeeshqqqesqkkqtpkkeqqqtpqtt 1485 Paramecium te...
XP_001014750 1474 ---------------------------------seveygiftetedelkskskpqsaepvkrvptrtskaelfeaspyyn 1520 Tetrahymena t...
EAK83798     1504 ----aahasyeegddeemggpsttedieaafsnggskkrssdvmdvdsdsesdssedgsineewaeqtcaleralqensk 1579 Ustilago mayd...
Q86H36       1350 -----------------------svaaksknkkkqnvnyedgeeeaeekdsdegeseaeesddksdvdsdsdeisnsrss 1406 Dictyostelium...
XP_001713248 1246 ---------------------------------------------------------------------flnlnmislei 1256 Guillardia theta
CAD25329     1140 ----------------------------------------vcleattgengdkdsedhstsyleatdetdqtddsgntee 1179 Encephalitozo...
XP_649386    1317 ------------------------------------eqnemseeeieteeksgssssseeeekeekkspleeekeeikek 1360 Entamoeba his...
Feature 1                                                                                         
NP_191325    1441 ksdrhifvkgeGEKFEVHFKFAtd----dpHILLAQIAQQTAQKVYIQNSGKIERctvancgdpqviyhgdnpkerreis 1516 thale cress
CAI73289     1768 vfhfaksleysEETSTMVLKFGwpvikcpyFLDLLPLLKQEISQLVLRDSYGIRQsrivfqtvddkeeytl--------- 1838 Theileria ann...
XP_001708867 1935 ledtalgvspdQLPLSVTIQFVnsd---psHVIALATIEKAIRSLVLKEVRGITRcfiryelpadryvmd---------- 2001 Giardia lambl...
XP_001450527 1486 qhkylekaevqKQLIKVVIKLPln----skKMLMTNVVKKTLSNTVINEIKGINKakiikndksggasfm---------- 1551 Paramecium te...
XP_001014750 1521 vsyqqifktikGERIVCNIKLPld----skKLLMVNLVEKILKKTLVYEVKNISNatvlkkdnkgatsyq---------- 1586 Tetrahymena t...
EAK83798     1580 yinafrfddvkARWAEFDLTLNtq----sqKLLLINIVERVCRQSVIHEIPNIARvmkpppkageegvsl---------- 1645 Ustilago mayd...
Q86H36       1407 nsfsdesiefdQKKLTFTISVAsd----skKVLMLGIVETEASKFVLKSCKGITRcfvnekqvggkthys---------- 1472 Dictyostelium...
XP_001713248 1257 inkkkkfridlGKLFQMNFNITs-------NFLLSNIILDYFTKRIQISGNNIEIffs---------------------- 1307 Guillardia theta
CAD25329     1180 eedfmnfakksKNVLTFEILYPsg-----fNEMISSVVESILPTIVVREVKGMEKasvsgsqlfvksssiys-------- 1246 Encephalitozo...
XP_649386    1361 pnlvekeekgkKQHLVVSVLLNvn-----dKVSMVSVVEKVIEKIILYECPHIVRgiplskkkegrtiyy---------- 1425 Entamoeba his...
Feature 1                                                                                         
NP_191325    1517 ndekkaspalhasgvdfpalwefqDKLDVRYLYSNSIHDMLNIFGVEAARETIIREINHVFKSYGISVSIRHLNLIADYM 1596 thale cress
CAI73289     1839 ---------hcdgtnlkrlfmlreNIVDFNRIKMNDVATVFKYYGIEAARSCIVSELQKVFSVYGIKVDYRHLTLIADFM 1909 Theileria ann...
XP_001708867 2002 ----------ieggnlralfylsnPFINFDNIYTNNISQIFEIYGIEAARNAIIEEIHRVFSTYHIEVDERHLSLIADSM 2071 Giardia lambl...
XP_001450527 1552 ----------iytegvnlnkirnfDFINLNNIDCNDIVAIMNAFGIEAARNAIIKEILAVFGAYGVAVDYRHLYLIADYM 1621 Paramecium te...
XP_001014750 1587 ----------iqtegvnfkqiwkmDHFDSNTIDSNDIAALNKCYGIEAARNAIVKEIVTVFGVYGVVVDYRHLYLIADYL 1656 Tetrahymena t...
EAK83798     1646 ---------taeginfrdlwdfgfGVIDLDNLYTNDIGAVLHTYGVEAARAAIVAEMRGIFDTYGIAVSPRHLFLIADYQ 1716 Ustilago mayd...
Q86H36       1473 ---------iqsegvnlseifelrDKLKIDEIYTNDIYAILQKYGVEACRQAVTSEISNVFAAYGISVDKRHLILLGDYM 1543 Dictyostelium...
XP_001713248 1308 ----------------------lsEFFKIDEIFTSDILKMSIIFGIEAGREILTIELMNIFKNQGIVISNKHIDTISDYM 1365 Guillardia theta
CAD25329     1247 --------ltrmievspgvyedllDILDIYNAESNDIYDVYLTLGVEAARHAIINEVVKVFDVYGISIDIRHLLLIADYM 1318 Encephalitozo...
XP_649386    1426 ---------vmtegvnfraalqfgNLVDVDTVETNDVYAVLNMYGVEAARTVLIHEIDSVFKAYGIDVDPRHLNLVADYM 1496 Entamoeba his...
Feature 1                                           #         ###     ## # #    #      
NP_191325    1597 TFSGGYRPMSRMGgiAESTSPFCRMTFETATKFIVQAATYGEKDTLETPSARICLGLPALSGTGCFDLM 1665 thale cress
CAI73289     1910 TQKGDVRTFTRYGm-ARHTSPLLQMSFESTMKFLMDASERGAYDNLKSPAGGLMTGKPVHVGSSLCRLM 1977 Theileria annulata
XP_001708867 2072 TLSGCVRGLNRLEm-RHQTEELLKASFESACTSLAAGALTSGFDSLRAPAGAVTVGQYPSQGTGSFDLL 2139 Giardia lamblia ATCC 50803
XP_001450527 1622 TFGGQIRAMNRIYm-DFNTAPFGKMTFETSTQFLTNACLNRETDTFNNLSSQLVIGRVPKVGSNLCDVL 1689 Paramecium tetraurelia
XP_001014750 1657 TFSGEMKAMNRVWm-DESISPFLKMSFETCVKFLTNAATNNEIDTLSTPSSSIVLGRVPQVGTGVFDIL 1724 Tetrahymena thermophila ...
EAK83798     1717 TAAGGFRPFNRSGi-SESSSTLLKASFEMTMAFIGGSALHGEVDMLKTPSSKLVVGRPVNSGTGTPEIR 1784 Ustilago maydis 521
Q86H36       1544 TFEGGYRALNRIGi-ENNTSPFQKMSFETTFSFLSKASLMGDYDTVTSPSSRIVLGQIVKNGTGSFTIV 1611 Dictyostelium discoideum...
XP_001713248 1366 TRLGYLRPFNRNY--MKEEAGIQEISYETALLHLKKYALGKKIESIECISDKIAFGLPCNIGTGLFEIN 1432 Guillardia theta
CAD25329     1319 TRKGSYSPFSRHGl-GADDSPIQRISFESCYSNFKTAATFHLEDKLSNPSASLTVGNPVRCGTGCFDLI 1386 Encephalitozoon cuniculi...
XP_649386    1497 TYEGEYKSLNRSGm-DHNPSPFTKITFETSLGFLAKTCVSGQKDNLRSPSGSVVMGKNMVFGTGAFDIY 1564 Entamoeba histolytica HM...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap