
Conserved Protein Domain Family

cd02655: RNAP_beta'_C 
Click on image for an interactive view with Cn3D
Largest subunit (beta') of Bacterial DNA-dependent RNA polymerase (RNAP), C-terminal domain
Bacterial RNA polymerase (RNAP) is a large multi-subunit complex responsible for the synthesis of all RNAs in the cell. This family also includes the eukaryotic plastid-encoded RNAP beta" subunit. Structure studies suggest that RNAP complexes from different organisms share a crab-claw-shape structure with two pincers defining a central cleft. Beta' and beta, the largest and the second largest subunits of bacterial RNAP, each makes up one pincer and part of the base of the cleft. The C-terminal domain includes a G loop that forms part of the floor of the downstream DNA-binding cavity. The position of the G loop may determine the switch of the bridge helix between flipped-out and normal alpha-helical conformations.
PSSM-Id: 132721
Aligned: 55 rows
Threshold Bit Score: 167.704
Threshold Setting Gi: 41017919
Created: 9-Oct-2007
Updated: 2-Oct-2020
Aligned Rows:
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:Rpb1 (beta') - Rpb2 (beta) interaction site [polypeptide binding site]
  • Comment:Bacterial RNAP beta' and beta subunits correspond to the Rpb1 (largest) and Rpb2 (second largest) subunits, respectively, of yeast RNAPII.
  • Structure:1HQM; Interface between the beta' (1HQM_D) and beta (1HQM_C) subunits of Thermus aquaticus RNAP; defined using 3.5A contacts
    View structure with Cn3D
  • Structure:2O5I; Interface between the beta' (2O5I_D) and beta (2O5I_C) subunits of Thermus thermophilus RNAP; defined at 3.5A contacts
    View structure with Cn3D

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1                #   #                                                                 
1HQM_D     954 RPVSIGEAVGVVAAESIGEPGTQLTMRTFHTGGVAVg------------------------------------------- 990  Thermus aquaticus
Q2EEX0     323 KRVAIGEAIGIIAAQSIGEPGTQLTLRTFHTGGVGGfsganwisynspfdgfikfkkpvignilrswivmphytslnlvy 402  Helicosporidium ...
NP_852645  301 KHNNLGKNVGILSGQVIGEPGTQLTLRTFHTGGTFTlnlnkiknkdnfifnykyffninkyklcvkyhkikrlknnnkil 380  Eimeria tenella ...
CAA64574   305 YKYNLGQHIGVISSEAISEPSTQMVLRTFHASSILKdkfnfnkyliykiylyklninkifkliinfkkyinikfnliflm 384  malaria parasite...
NP_044750  909 EIVSLEESIGIIAAQSIGEPGTQLTMRTFHQGGTVLrganenrlyssynarvliynrkvvkginsitkinihrnskillf 988  Reclinomonas ame...
Q05FH9     835 KIVLIGVSVGIISAQSIGEPGTQLTMRTFHTGGVASyffysdnliisnsgfvkfkkckcvinkfgeviivslygefmifn 914  Candidatus Carso...
Q9PQV5    1016 KLIETGTAIGVIAAQSIGEPGTQLTMRTFHTGGVAGd------------------------------------------- 1052 Ureaplasma parvum
Q6F0L8     965 SLVKIGEPVGVIAAQSIGEPGTQLTMRTFHTGGVAGd------------------------------------------- 1001 Mesoplasma florum
Q98Q24    1104 RIVSIGEAVGITASQSIGEPGTQLTMRTFHSGGVAGv------------------------------------------- 1140 Mycoplasma pulmonis
P47582    1006 KLVELGTAVGVIAAQSIGEPGTQLTMRTFHTGGVSTe------------------------------------------- 1042 Mycoplasma genit...
Feature 1                                                                                      
1HQM_D         --------------------------------------------------------------------------------      Thermus aquaticus
Q2EEX0     403 kltpsfnelnltlfifdklknelynktlknegllfvregdfikkgqllfseininfknsnllktyipyysletgliispk 482  Helicosporidium ...
NP_852645  381 yfiylknnyfifksfyilfilkkykfnqilsinnrliysknniylsnllliylninniyqrkslininheqnytgeflyk 460  Eimeria tenella ...
CAA64574   385 nkilynynnilfeykyilqnqyikcnfiynsisknfkynlnniiikylnnvikyynysniqlliknihnkwilyniytyy 464  malaria parasite...
NP_044750  989 dlnysllisykipygatlyvddgsiiskgtllfdynsytipil------------------------------------- 1031 Reclinomonas ame...
Q05FH9     915 kiilekykfyygtkikfrngflikkntklinfndnnfy------------------------------------------ 952  Candidatus Carso...
Q9PQV5         --------------------------------------------------------------------------------      Ureaplasma parvum
Q6F0L8         --------------------------------------------------------------------------------      Mesoplasma florum
Q98Q24         --------------------------------------------------------------------------------      Mycoplasma pulmonis
P47582         --------------------------------------------------------------------------------      Mycoplasma genit...
Feature 1                                                                                      
1HQM_D         --------------------------------------------------------------------------------      Thermus aquaticus
Q2EEX0     483 lalnkylyplwiflfniiklnldslnskkftvyknysilekndlidlktilfeihfiqkskkfnlkkqeyllyqnlkmsl 562  Helicosporidium ...
NP_852645  461 nilqliiknkyykwiiinlnttilfnkyfpinyniikekiifiksknqryiklyliknknflysyrkyinklyhlkkifi 540  Eimeria tenella ...
CAA64574   465 lyyyhikfynlynkgiilnnnnnkynviyflinyfnlfsnyyykiynnnynfinsny----------------------- 521  malaria parasite...
NP_044750      --------------------------------------------------------------------------------      Reclinomonas ame...
Q05FH9         --------------------------------------------------------------------------------      Candidatus Carso...
Q9PQV5         --------------------------------------------------------------------------------      Ureaplasma parvum
Q6F0L8         --------------------------------------------------------------------------------      Mesoplasma florum
Q98Q24         --------------------------------------------------------------------------------      Mycoplasma pulmonis
P47582         --------------------------------------------------------------------------------      Mycoplasma genit...
Feature 1                                                                                      
1HQM_D         --------------------------------------------------------------------------------      Thermus aquaticus
Q2EEX0     563 ckshydystykklnvafqqnnqklnffynkklksslvsnninllwtsssysiniltksifniivfeylylslliknkyil 642  Helicosporidium ...
NP_852645  541 lniffsinyllliekylilkn-------------------------------tyilnynikyifniyntinlikckkkii 589  Eimeria tenella ...
CAA64574       --------------------------------------------------------------------------------      malaria parasite...
NP_044750      --------------------------------------------------------------------------------      Reclinomonas ame...
Q05FH9         --------------------------------------------------------------------------------      Candidatus Carso...
Q9PQV5         --------------------------------------------------------------------------------      Ureaplasma parvum
Q6F0L8         --------------------------------------------------------------------------------      Mesoplasma florum
Q98Q24         --------------------------------------------------------------------------------      Mycoplasma pulmonis
P47582         --------------------------------------------------------------------------------      Mycoplasma genit...
Feature 1                                                                                      
1HQM_D         --------------------------------------------------------------------------------      Thermus aquaticus
Q2EEX0     643 wilsknlkkkdkfhffkytstssskieifrlnskknslnirknklffysqnykknkvsnilfgnsiflkfplkkintffs 722  Helicosporidium ...
NP_852645  590 iwfkmflkvfytklkkknilkknniifpiklhinnniyifiyfkyfkinnitlsfnnliykesysiykkknklfnlinny 669  Eimeria tenella ...
CAA64574   522 ----------------yfkkmnfilknfnniqilnklfyvnnifiyykyekklfiylniinniiikkylnfykytynklf 585  malaria parasite...
NP_044750      --------------------------------------------------------------------------------      Reclinomonas ame...
Q05FH9         --------------------------------------------------------------------------------      Candidatus Carso...
Q9PQV5         --------------------------------------------------------------------------------      Ureaplasma parvum
Q6F0L8         --------------------------------------------------------------------------------      Mesoplasma florum
Q98Q24         --------------------------------------------------------------------------------      Mycoplasma pulmonis
P47582         --------------------------------------------------------------------------------      Mycoplasma genit...
Feature 1                                                                                      
1HQM_D         --------------------------------------------------------------------------------      Thermus aquaticus
Q2EEX0     723 qikqktinlkekktsnvegefigfqlknnikfwysispnslfsfkkdnkknrynfnfirknsnisgflvsntiktftlqk 802  Helicosporidium ...
NP_852645  670 ipklylidnlfyktiliqynfidinylfikniiipknivsqilhrqfinnnfnilllnnnkylinnflhiyyiyknyiyi 749  Eimeria tenella ...
CAA64574   586 fikkynnflylyeifkynwykylllnnkynlyiiynnyikylykynininlyfiknlfynnnnfihnhiiyknnyyiynn 665  malaria parasite...
NP_044750 1032 ------------------------------snykgnvffqeknqkissvkvrdsmsgivksnfnlginnfkrwflvnnsl 1081 Reclinomonas ame...
Q05FH9     953 -----------------------------------iysenigyvyfkkennivknyclednkfyyktlknfkitiinksi 997  Candidatus Carso...
Q9PQV5         --------------------------------------------------------------------------------      Ureaplasma parvum
Q6F0L8         --------------------------------------------------------------------------------      Mesoplasma florum
Q98Q24         --------------------------------------------------------------------------------      Mycoplasma pulmonis
P47582         --------------------------------------------------------------------------------      Mycoplasma genit...
Feature 1                                                                                      
1HQM_D     991 ------------------------------------tDITQGLPRVIELFEARRpkakaviseidgvvrieegedrlsvf 1034 Thermus aquaticus
Q2EEX0     803 giplifpsdtiyhkmekdfifknellcsfkslkpetqDIIQGIPRVEKLLEGRPlpfykpkvelykiwqfflknl----- 877  Helicosporidium ...
NP_852645  750 ttyytywknlfsnkyifnffrgiilnkkkyysnnsikDITSGLILIEIIFEAKIlpniyfipqkln-------------- 815  Eimeria tenella ...
CAA64574   666 nmnlyqynknilinnnllynklfynyinnniynlylnDITIGLQSINIIFENKNikdniffisnniyvifyikyynylnn 745  malaria parasite...
NP_044750 1082 kieninmsqdllnimensivkkgdvigrinisnkivqDITGGLSKISKLFECIQnqsclitpvegyikfnyepsvs---- 1157 Reclinomonas ame...
Q05FH9     998 kknyfipknfnivvycydyifpgeiiaklvsvtilksSIIGGLPRLSELFEARIpklkallseidgvckikfshlnyiit 1077 Candidatus Carso...
Q9PQV5    1053 ------------------------------------tNITQGFERIKQLFDCIQpqenekavisqvkgtveriekdsntn 1096 Ureaplasma parvum
Q6F0L8    1002 ------------------------------------aDITQGLPRIKELLDVTTqkgsvaiiaekagvvsdiinkngint 1045 Mesoplasma florum
Q98Q24    1141 ------------------------------------eDITGGFGRLTELIDAYRspwgrpaiiskvdgiiteiktpkdkn 1184 Mycoplasma pulmonis
P47582    1043 ------------------------------------nNLAQGFERLKQIFEVVTpkdfekavisevkgtvksittvqnaq 1086 Mycoplasma genit...
Feature 1                                                                                      
1HQM_D    1035 veseg----------fskeyklpkdarllvkdgdyveagqpltrgaIDPHQLLEAk------------------------ 1080 Thermus aquaticus
Q2EEX0     878 -------------------------gflkiknslfnlkkveskvylNNFKPNLNIgdicy-------------------- 912  Helicosporidium ...
NP_852645  816 -----------------------------------iltnifllyeeNTLNYLWNYslytfsynkkkllffteinsysnyi 860  Eimeria tenella ...
CAA64574   746 iiyiynicn--kyninhykyklnfysyifedissilysgyslhtefYSINKNLKYyfrfllksi---------------- 807  malaria parasite...
NP_044750 1158 -------------------------kfvlyvltkdektkkdllvriGTVHELDNLfvrqndyvyqgdll----------- 1201 Reclinomonas ame...
Q05FH9    1078 iiskfg---------fykeytlsclrklyinngdyvkigdilsdgkPDLNEIINLi------------------------ 1124 Candidatus Carso...
Q9PQV5    1097 gynvviky----nkdnyvnyptrsnavlrvktgdeiiagqkitegsIDVNDLLKYa------------------------ 1148 Ureaplasma parvum
Q6F0L8    1046 ivvteevn----gtqiekqyktmynavlrvnkgdqvkpgkkltegsINLHDLLEVa------------------------ 1097 Mesoplasma florum
Q98Q24    1185 tnlvyityldqddasqtevvsvpknrtlrvkvgdkivkgqkiidgpIILEELLEYg------------------------ 1240 Mycoplasma pulmonis
P47582    1087 evviksn-------vderiytipfsaqirvhvgdqvspgskitegsVDIKQLLRIa------------------------ 1135 Mycoplasma genit...
Feature 1                                                                                      
1HQM_D    1081 --------------------------------------------GPEAVERYLVDEIQKVYRAQGVKLHDKHIEIVVRQM 1116 Thermus aquaticus
Q2EEX0     913 ---------------------------------------layfhSKSNFGLDIASIISNVYLQEGVNISFKHIELIVREL 953  Helicosporidium ...
NP_852645  861 yenktsiltpnniiipgnysinilllklfshnlnfymqdqaiklSHIFIFNLIVESLLKQYFKNGINIPSIQFELIAKKM 940  Eimeria tenella ...
CAA64574   808 ------------------------------------niyqatksSYIYVYNILIESILKQYSYQNIYLPSIYFELIIKKM 851  malaria parasite...
NP_044750 1202 ------------------------------ssgivpireiaekiEFESSFYHLLEQIQSTYFENGVTINQKHIEVIISQM 1251 Reclinomonas ame...
Q05FH9    1125 --------------------------------------------SINYLLSYFVNEINSIYFPQNIYVNCKHIELILKQM 1160 Candidatus Carso...
Q9PQV5    1149 --------------------------------------------GIENVRHYIIKEVQKVYRMQGIEISDKYIEVIISQL 1184 Ureaplasma parvum
Q6F0L8    1098 --------------------------------------------GTTAVQNYILKEVQKVYRLQGIEISDKYIEIIVKQM 1133 Mesoplasma florum
Q98Q24    1241 --------------------------------------------GPRKVQSYLLKEIQKIYRMQGIAINDKYIEIIISQM 1276 Mycoplasma pulmonis
P47582    1136 --------------------------------------------GIQRVRQYMIVEIQKVYRIQGIDIADKYVEIIIRQL 1171 Mycoplasma genit...
Feature 1                                                                                      
1HQM_D    1117 LKYVEVTDPGdsp-lleGQVLEKWDVEALNerli-----------------aegkVPVAWKPLLMGVTKSALSTKSWLSA 1178 Thermus aquaticus
Q2EEX0     954 TSLVEIINPGdsg-fivKEKIHWLLIYNYNkrlk-----------------slnlKEISYMPIFLGMTEITKKKNSFGVA 1015 Helicosporidium ...
NP_852645  941 TSFVKINYSGdsa-lleNDIFDFNKLKILNyily-----------------tlgyKQILYSPVVLGITKSVLACSGFFAS 1002 Eimeria tenella ...
CAA64574   852 LSCIKIISNNfki-fkyNDIISLQLINIINysln-----------------lnkhYIYKYEPIILGITKSILANSGFLTN 913  malaria parasite...
NP_044750 1252 FFKITCMDLYldkdhfiNETKTSEIKEKINikykptrfnkdffchqsirllvmglLPIKGKISLGGISQIGVLGGSFLSS 1331 Reclinomonas ame...
Q05FH9    1161 TKKVKIIFSGess-cqqGDILFLEDAINENfstl-----------------vnsrRLSYYKRIVTGITKTSLESLSFFSA 1222 Candidatus Carso...
Q9PQV5    1185 TNKITITNPGdsg-lfvGETISINEFTEVAqnml-----------------vnkkKPPSAINQVFGLDHAPSKSGSFLSA 1246 Ureaplasma parvum
Q6F0L8    1134 LNKVKVIQSGesh-llqGEIVTQQKFKEVVtqci-----------------reglVPPVAKNQILGIKKAPLKSESWLSS 1195 Mesoplasma florum
Q98Q24    1277 LSKIEISEPGdsd-fiiGSLVNNLDFYNTNnell-----------------ekglEPAKGKVVIHGAKRIPLLSNSFLAA 1338 Mycoplasma pulmonis
P47582    1172 TNLLQVTDAGnsn-lfvGQLVHSHYLNELNksll-----------------lagkMPVIAINQVFGIDEAASKSNSFLSA 1233 Mycoplasma genit...
Feature 1                        #     #     #  ##   #  
Q2EEX0    1016 GSFQNLREIIIDHTFTRKTDYLLGLHENVLFNKIIPAGTGF 1056 Helicosporidium sp. ex Simulium jonesii
NP_852645 1003 ISFQEIIKFLKKLSIEHSIDWLSDLKSNIITTNLIKTGSGW 1043 Eimeria tenella strain Penn State
CAA64574   914 ISFQNTFKIISLNILNNKIDWLIDIKSKIILTDLLPVGNGW 954  malaria parasite P. falciparum

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap