1K4V,1LZI


Conserved Protein Domain Family
Glyco_transf_6

?
cd02515: Glyco_transf_6 
Click on image for an interactive view with Cn3D
Glycosyltransferase family 6 comprises enzymes responsible for the production of the human ABO blood group antigens.
Glycosyltransferase family 6, GT_6, comprises enzymes with three known activities: alpha-1,3-galactosyltransferase, alpha-1,3 N-acetylgalactosaminyltransferase, and alpha-galactosyltransferase. UDP-galactose:beta-galactosyl alpha-1,3-galactosyltransferase (alpha3GT) catalyzes the transfer of galactose from UDP-alpha-d-galactose into an alpha-1,3 linkage with beta-galactosyl groups in glycoconjugates. The enzyme exists in most mammalian species but is absent from humans, apes, and old world monkeys as a result of the mutational inactivation of the gene. The alpha-1,3 N-acetylgalactosaminyltransferase and alpha-galactosyltransferase are responsible for the production of the human ABO blood group antigens. A N-acetylgalactosaminyltransferases use a UDP-GalNAc donor to convert the H-antigen acceptor to the A antigen, whereas a galactosyltransferase uses a UDP-galactose donor to convert the H-antigen acceptor to the B antigen. Alpha-1,3 N-acetylgalactosaminyltransferase and alpha-galactosyltransferase differ only in the identity of four critical amino acid residues.
Statistics
?
PSSM-Id: 133008
View PSSM: cd02515
Aligned: 11 rows
Threshold Bit Score: 413.261
Threshold Setting Gi: 47215191
Created: 10-Apr-2003
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
substrateactive site
Conserved site includes 12 residues -Click on image for an interactive view with Cn3D
Feature 1:substrate binding site
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                ###  #                                  
1K4V_A        15 RPEVVTMTKWKAPVVWEGTYNraVLDNYYakQKITVGLTVFAVGRYIEhYLEEFLTSANKHFMVGHPVIFYIMVD--DVS 92  cow
1LZI_A        19 RKDVLVVTPWLAPIVWEGTFNidILNEQFrlQNTTIGLTVFAIKKYVA-FLKLFLETAEKHFMVGHRVHYYVFTD--QPA 95  human
AAH52142      43 RTDVVTLTPWLAPVVWTGTFDskMIDSIYkhQNITVATTVFALGKYTR-FLKDFLESAEEHYFDGFRVHYYLFTD--QPE 119 zebrafish
Q8N5D6        76 PTQLLTLTPWLAPIVSEGTFNpeLLQHIYqpLNLTIGVTVFAVGKYTH-FIQSFLESAEEFFMRGYRVHYYIFTD--NPA 152 human
NP_001025854  72 RQDVLTVTPWLAPIVWEGTFSpeILDSAYmpLNLTIGVTAFAVGKYTR-FVSRFLKSAEMHFMKGYRVNYYIFTD--NPK 148 chicken
AAH86458      64 RTDVLSVSPWLAPIVWEGNFNidILNEQFhqRDVRIGLTVFAIKKYIR-FLKTLIETAEKFFMVGHQVNYYVFTDlvRNV 142 African clawed ...
CAG01398       3 AAQMPLETSWGAPLVWGDSRKsaKRRAKLgeLEIRTGLAALVVGTYAK-FARRFLSSAEIYFLPDQTVTYYILTDn-PRT 80  Tetraodon nigro...
CAG07026      22 RGDVQTCTPWKAPIIWEGMFDpeLYDRTHqkEGTSVALTVFAVGRYLEaYLEAFLQSAERHFMVGLPVIYYVFTD--KPD 99  Tetraodon nigro...
EAX07463      80 RPEVLTCTPWGAPIIWDGSFDpdVAKQEArqQNLTIGLTIFAVGRYLEkYLERFLETAEQHFMAGQSVMYYVFTE--LPG 157 human
XP_548383     49 RPDVVTTTDWLAPVIWEGTFNrrVLEEYYrgQDLTIGLAVLATGRIADqYLELFIQSANKHFMTGYRVIFYIMVD--AMC 126 dog
NP_001034184  45 RLDVITTTDWLAPIIWEGTFDrkVLETYFrkQNITVGLAVFAVGSLTDkYLDPFLQSASKFFMPGYRVIFYIMVD--KYL 122 house mouse
Feature 1                                  #   #                      ###                        
1K4V_A        93 RMPLIELGPLRSFKVFKIKPeKRWQDISMMRMKTIGEHIVAHIQHEVDFLFCMDVDQVFQDKFGVETLGESVAQLQAWWY 172 cow
1LZI_A        96 AVPRVTLGTGRQLSVLEVRAyKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFY 175 human
AAH52142     120 AVPEVKMGENHRLTVRKVPSlDRWQDISMGRMEILEKLIADELMHEANYIFCLDVDTKFYGRWGSETLGNLVGVIHPWFF 199 zebrafish
Q8N5D6       153 AVPGVPLGPHRLLSSIPIQGhSHWEETSMRRMETISQHIAKRAHREVDYLFCLDVDMVFRNPWGPETLGDLVAAIHPSYY 232 human
NP_001025854 149 MIPDVQLQPGRRFDVVHIKKySSWQEISVRRMEAINLHIAERSHREVDYLFCLDIDMVFHNAWGAETLGDMVAAIHPGYF 228 chicken
AAH86458     143 TNFNITVGTGRRLVFLEVPSyKRWQDVSMRRMQMIRDASQQRFAYEVDYLVCIDVDMRFQDHVGVEILSDVFGTLHPAFF 222 African clawed ...
CAG01398      81 LEPPVKLGPGRKLTVIHIAElPGWSRLAYRRMSLLADAIRDLIGSEVEYVFCADVDQEFVAPVGTEILGDLVATLHPELY 160 Tetraodon nigro...
CAG07026     100 KIPHIELGPRREIKVVQVHRdSRWQDISMKRMKTIAETIESDIRHHCQYVFCLDVDQVFTGRFGPEALGESVGLLHAYYY 179 Tetraodon nigro...
EAX07463     158 AVPRVALGPGRRLPVERVAReRRWQDVSMARMRTLHAALGGLPGREAHFMFCMDVDQHFSGTFGPEALAESVAQLHSWHY 237 human
XP_548383    127 RLPNLEPGPLQTFQVFTIRE-DSREDFHLMHMKNLASHILGHIQDEVDFLFSMTANRVFQNDFGVETLGTSVAQLHAWWY 205 dog
NP_001034184 123 QLQEMEHNPLQSFQVLKIGKeRWWSNFDLMRMKILSEHIRDHIRYEVDFLFSMNINMVFQSEFGVETLSTSVAQLHPWWY 202 house mouse
Feature 1                                                                                        
1K4V_A       173 KADPNDFTYERRKESAAYIpfGEGDFYYHAAIFGGTPTQVLNITQECFKGILKDKKNDieaqWHDESHLNKYfl-lnKPT 251 cow
1LZI_A       176 GSSREAFTYERRPQSQAYIpkDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGieavWHDESHLNKYll-rhKPT 254 human
AAH52142     200 DYPRESFTYERRPESKAFIavGEGDYYYTAAAFGGTLEEIHRLTKTCREQLNADHENSieaiWHEESHLNKYfl-ynKPT 278 zebrafish
Q8N5D6       233 AVPRQQFPYERRRVSTAFVadSEGDFYYGGAVFGGQVARVYEFTRGCHMAILADKANGimaaWREESHLNRHfi-snKPS 311 human
NP_001025854 229 NVPRSQFPYERRSSSAAYIpdGEGDFYYGGAVFGGLVKKVYEFTKICHMTILADKANGimaaWQEESHLNRHfl-thKPS 307 chicken
AAH86458     223 VKTRHQFTYERRPQSQAYIpeDEGDFYYAGGYFGGKIEEVYKLTNHCHHAMLTDKANNieavWHDESYLNNYflyykKPT 302 African clawed ...
CAG01398     161 GMPRKAFPYQVEESSAAHVeeEEGDYYYTSELYGGAVSEVYRLVRACSLLILQDQANGvvarGLEESYLNRYli-dhRPT 239 Tetraodon nigro...
CAG07026     180 RLPKRFYTYDRNPKSVAYM--ERGDFYYHAAVFGGSWRWVKALTEACYQGIMEDKKNHvealWHDESHLNKFml-lhKPS 256 Tetraodon nigro...
EAX07463     238 HWPSWLLPFERDAHSAAAMawGQGDFYNHAAVFGGSVAALRGLTAHCAGGLDWDRARGlearWHDESHLNKFfw-lhKPA 316 human
XP_548383    206 FKDIKDFPYERRFRSAACIllGEGDFYYDGSVVGGTPLEILDFIQEYLEGMIHDKENGl--nSTYERYLNKYff-thKPT 282 dog
NP_001034184 203 FRKRTNLPYERKPTSVAHIpfGLGDFYYAGAIIGGVPFQVLDFAQQYLKGVFLDTENGv--nSTYEKYLNKYff-lnKPT 279 house mouse
Feature 1                                     # #   #
1K4V_A       252 KILSPEYCWdyhig-lpadIKLVKMSWQTKEYNVVR 286 cow
1LZI_A       255 KVLSPEYLWdqqllgwpavLRKLRFTAVPKNHQAVR 290 human
AAH52142     279 KLLSPEYLWrdini-sagqIRIVRFSHVAKNNAEVR 313 zebrafish
Q8N5D6       312 KVLSPEYLWddrkp-qppsLKLIRFSTLDKDISCLR 346 human
NP_001025854 308 KLLSPEYLWddrkp-kppeIFLIRFSTVDKNYQEVR 342 chicken
AAH86458     303 KILSPEYLWnerdg-tahyLRKRRLIALHKNPDEVR 337 African clawed frog
CAG01398     240 CVLSPEYSWwdsd--matnVPVPRLVSLGRQTRGSG 273 Tetraodon nigroviridis
CAG07026     257 RVLSPEYCWdpdig-qrtdIRVARLIWAPKDYEGLR 291 Tetraodon nigroviridis
EAX07463     317 KVLSPEFCWspdig-praeIRRPRLLWAPKGYRLLR 351 human
XP_548383    283 KLLSPEYSWdt-------aLQLPAQIWLVKAAQCSH 311 dog
NP_001034184 280 KLLSPEYSWdp-------tFNLPRHVWFVKIAHHPI 308 house mouse

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap