Conserved Protein Domain Family
CCC1_like_1

?
cd02437: CCC1_like_1 
CCC1-related protein family
CCC1_like_1: This is a protein family closely related to CCC1, a family of proteins involved in iron and manganese transport. Yeast CCC1 is a vacuole transmembrane protein responsible for the iron and manganese accumulation in vacuole.
Statistics
?
PSSM-Id: 153128
View PSSM: cd02437
Aligned: 10 rows
Threshold Bit Score: 115.209
Threshold Setting Gi: 44920984
Created: 15-Apr-2005
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_069464    24 VSRRYFIIGFFDGVLt--iLGLIIGSHLSgei--------saRLVITAGVATALALGISSSWGAFEAERIEQKimkdqke 93  Archaeoglobus fu...
AAX80633     47 SLVCGCLTGFTCAAGaigaLAGMYRSSLGstsqdkrfaplliAHAFSGGVGIAFTVCRSLLFERAVYEVELQRelweidn 126 Trypanosoma brucei
CAF30220     14 FDTRYVVRGLIDGSLs--tLGVVIGASGGe-----------tSIIIAAGIGGGIANGISNILGALTAERAIIEeerekke 80  Methanococcus ma...
YP_192370   171 RVVQPGLVGLMDGSVs--tLAPVFAAAFAth---------spHAAFLVGLAASLGAGISMGLAEALADDGKLSghg---- 235 Gluconobacter ox...
YP_154924   411 NRIKRGIESYYDGNSvtivPVHLMAAKMAmdd--------rcKADKTAFRSGSRVDNFFNEIRENVIELGQLRksqtlld 482 Idiomarina loihi...
Q58061       19 SGTRYIVRGLIDGSLs--aLGVVIGASGSad----------aSVIIAAGLGGGIANGLSNILGAFTAEKASLEreriqke 86  Methanocaldococc...
AAL51535    124 TYIQPGLAGLMDGSVs--tLAPIFAAAFAtq---------dtWQTFLVGLSASVGAGISMGFTEAVHDDGKLSgrg---- 188 Brucella meliten...
ZP_00148769   6 EQGRYIILGSIDGILa--vLGVVIGTSHVvd---------dpSIIINAALGGAVALALTNGIGSYLAESAVEYgnlaele 74  Methanococcoides...
AAP98827     34 TTFKGFFYHLANNALs--tGVFIFFIRTLfflipt-nralqvKSLISLGVGWTFYHGCLKARKAWAYMELSHRsmleekn 110 Chlamydophila pn...
NP_220247    33 QTKKGYWYHLTCDAId--cGVFLFFIRTIfflvpaipvtsygKILFATGISWIFYTSCKRAQAAWAYIELTHRnmlqekk 110 Chlamydia tracho...
NP_069464    94 kallvns------------------------------------------------------------------------- 100 Archaeoglobus fu...
AAX80633    127 hiageiqemvaiyraqglleeeahmit----------------------------------------------------- 153 Trypanosoma brucei
CAF30220     81 kslligngn----------------------------------------------------------------------- 89  Methanococcus ma...
YP_192370       --------------------------------------------------------------------------------     Gluconobacter ox...
YP_154924   483 ntacrlcrmlsvvrekqessvkvakdienkqqkllklidkqvkknksafirelkltmesehgsakdfasenykgkkkdie 562 Idiomarina loihi...
Q58061       87 ksllkkngy----------------------------------------------------------------------- 95  Methanocaldococc...
AAL51535        --------------------------------------------------------------------------------     Brucella meliten...
ZP_00148769  75 kpllrsl------------------------------------------------------------------------- 81  Methanococcoides...
AAP98827    111 eieenfeqekielrilfenqgfkdp------------------------------------------------------- 135 Chlamydophila pn...
NP_220247   111 eietnpeqerielavlyanqgfqep------------------------------------------------------- 135 Chlamydia tracho...
NP_069464   101 -------------------------------------------------restidrahrfaayVSSIIHGIAPIIGAILP 131 Archaeoglobus fu...
AAX80633    154 -----------------------------rifakhreafanlmmveelgysrleppagweavvDAAIPSSIGYTLGWVLP 204 Trypanosoma brucei
CAF30220     90 ------------------------------------------------lkgtheyqyklnktmYSGTYDGLSTCVGAVIP 121 Methanococcus ma...
YP_192370   236 ------------------------------------------------------------aplLRGLICGAMTFGGGIGH 255 Gluconobacter ox...
YP_154924   563 rnwkkeaeridqqlkeklevklkdsaavvqeavneamediaigfdaireadfdeqstfntsrlMSALGALMSTGGGAALI 642 Idiomarina loihi...
Q58061       96 ------------------------------------------------lkksiiykkairetmICGLIDGISTTIGSALP 127 Methanocaldococc...
AAL51535    189 ------------------------------------------------------------spiKRGISCGVMTTLGGLGH 208 Brucella meliten...
ZP_00148769  82 -------------------------------------------------gsttierdtkkkiwNDSITHGGSSFIGSLVP 112 Methanococcoides...
AAP98827    136 -------------------------------llqemveyvcsdstllldtmireelyirkedlPHPLIQGGSRILGGLCG 184 Chlamydophila pn...
NP_220247   136 -------------------------------lisqmldfvcsdsslllstmlreelhiqledyPHPLKQGNVKALGGILG 184 Chlamydia tracho...
NP_069464   132 LIPYAFLPl-----------eEAFVMAVAi--GFASLFILGAVMGKSAKfnvfv-sgfrMFLAGVVTAVIVTILSPSHFI 197 Archaeoglobus fu...
AAX80633    205 LLPFMGSElssarselvalctLAAGIFVVsvgQSEVFFGSYANVWKAVGat-------vWNLSAAGLTYGATRFMACRSG 277 Trypanosoma brucei
CAF30220    122 VIPFFIFDq-----------sTALIMAIAf--TLLILLGLGIFIGKLSRdnll---isgLKMVLGGVIVAVICFGVESLF 185 Methanococcus ma...
YP_192370   256 TLPFLVPDf-----------hLAFGVAIIa--VAIELLLISWVRWRYQDtp-------fGSAMVQVFLGGALVFATGVLI 315 Gluconobacter ox...
YP_154924   643 IIGSMSTPag----------wVAAGFVVV---GIFAGFCSGLVKSKERKrkeaidailkQANKNLDDLEQSYTEQVDKLF 709 Idiomarina loihi...
Q58061      128 VVPFFLFDi-----------kTALYVAIGi--TIAILFILGVFIGKISKenvi---isgIKMVAGALAVAILCFMIEKAF 191 Methanocaldococc...
AAL51535    209 SLPYLIKDf-----------wSATSIAVIl--VFFELWAIAFIQNRYMEtp-------fFRAALQVVFGGALVLAAGILI 268 Brucella meliten...
ZP_00148769 113 IMPFVLFDsf----------sLEIAIILSi-sVLAILGIYSGKIAKQSLi---------KHAVRMVGLGILIVLAVTSLG 172 Methanococcoides...
AAP98827    185 LAIFLPLV-------------LCISYTLAgvfSALMVLVLSFLKAKILKndki---semVWVLGIFITSASIISSLMKLL 248 Chlamydophila pn...
NP_220247   185 LLLFAPIT-------------LAVSYTIAa--ILASFMIGVLFAVKTRLiknai-apaiVWGVGMFITAISLCCSLIRLF 248 Chlamydia tracho...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap