1N1D


Conserved Protein Domain Family
G3P_Cytidylyltransferase

?
cd02171: G3P_Cytidylyltransferase 
Click on image for an interactive view with Cn3D
glycerol-3-phosphate cytidylyltransferase
Glycerol-3-phosphate cytidylyltransferase,(CDP-glycerol pyrophosphorylase). Glycerol-3-phosphate cytidyltransferase acts in pathways of teichoic acid biosynthesis. Teichoic acids are substituted polymers, linked by phosphodiester bonds, of glycerol, ribitol, etc. An example is poly(glycerol phosphate), the major teichoic acid of the Bacillus subtilis cell wall. Most, but not all, species encoding proteins in this family are Gram-positive bacteria. A closely related protein assigned a different function experimentally is a human ethanolamine-phosphate cytidylyltransferase.
Statistics
?
PSSM-Id: 173922
View PSSM: cd02171
Aligned: 6 rows
Threshold Bit Score: 209.263
Threshold Setting Gi: 15672906
Created: 19-Jan-2005
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
active site
Conserved site includes 22 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1           ####   # ##  #               #   #   # #                        #     #   
1N1D_A      1 MKKVITYGTFDLLHWGHIKLLERAKQLGDYLVVAISTDEFNLQKQKKAYHSYEHRKLILETIRYVDEVIPEKNWEQKKQD 80  Bacillus subtilis
AAC07343    5 GKVVITYGTFDLFHIGHLNLLKRAKALGDFLIVGVSTDEFNAIKGKKSVYPYEHRAEIVRSIKYVDLVIPERNWEQKIED 84  Aquifex aeolicus VF5
CAD67945    2 GKVVITYGTFDLFLICHLNLLKRAKALGDYLIVGVSTDEFNAVKGKKALIPFEQRAEIVASIKYVDLVIPETCWEQKIED 81  Thermotoga sp. RQ2
YP_087850   2 AKTIITYGTFDLFHIGHLRLLQRLKKLGDKLIVAVSTDEFNEGKGKKTVIPYEQRAEIVANIKCVDLVIPETAWEQKITD 81  Mannheimia succini...
AAT06400    1 MKKVLTYGTFDLLHHGHIRLLERARSLGDHLTVAISTDQFNLGKGKVCAYTYEERAHILKAIRYVDEVIPETNWEQKVED 80  Actinobacillus ple...
NP_267080   4 EKVVLVAGTFDILHESHVNMLRNAKNLGSKLIVMLSTDEFNAGKGKKAFQDYDTRKYVLESIRYVDLVVPEQSWDDKSLY 83  Lactococcus lactis...
Feature 1               ## ##   #                ##  #            
1N1D_A     81 IIDHNIDVFVMGDDWEGKFDFLKDQ---CEVVYLPRTEGISTTKIKEEIAGL 129 Bacillus subtilis
AAC07343   85 IKKYNVDVFVMGDDWKGKFDYLKEY---CEVVYLPRTEGISTTELKEALVKL 133 Aquifex aeolicus VF5
CAD67945   82 IKKYNVDILVMGKDWEGKFDYLKKY---CEVVYLERTKGISSSYLRSILKKV 130 Thermotoga sp. RQ2
YP_087850  82 VQKYDVDVFAIGNDWEGKFDFLKEY---CDVVYLERTKDISSTQLKQTLKSF 130 Mannheimia succiniciproducens MBEL55E
AAT06400   81 VKNHEIDVFVMGDDWEGKFDFLADY---CEVVYLPRTPDISTTQVKKMLAKK 129 Actinobacillus pleuropneumoniae
NP_267080  84 IDMFDVDIFAMGDDWKGKFDFLKEEfpnLKIMYFPRGKVSSSNIKKEMGKLY 135 Lactococcus lactis subsp. lactis Il1403

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap