1IHO,1VLH,1EUQ,1N1D,1I6M


Conserved Protein Domain Family
nt_trans

?
cd02156: nt_trans 
Click on image for an interactive view with Cn3D
nucleotidyl transferase superfamily
nt_trans (nucleotidyl transferase) This superfamily includes the class I amino-acyl tRNA synthetases, pantothenate synthetase (PanC), ATP sulfurylase, and the cytidylyltransferases, all of which have a conserved dinucleotide-binding domain.
Statistics
?
PSSM-Id: 173912
View PSSM: cd02156
Aligned: 5 rows
Threshold Bit Score: 67.949
Threshold Setting Gi: 8569293
Created: 7-Mar-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:Residues that are generally conserved in the active site based on multiple structure evidences (using 3.5A).
  • Structure:1I6M_A; Geobacillus stearothermophilus TrpRS bound to Tryptophanyl-5'AMP using 3.5A
    View structure with Cn3D
  • Comment:Includes ATP binding sites (HIGH and KMSKS motifs)

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                 ####                                                                
1IHO_A     24 VALVPtmg--nlHDGHMKl-VDEAKara----dvVVVSIFVNpmqfdrp-edlarypRTLQEDCEKlnkrkvdlvfapsv 95  Escherichia coli
1VLH_F     14 KAVYPgsf-dpiTLGHVDi-IKRALsif----deLVVLVTENprkkc-----mftleERKKLIEEVlsdldgvkvdvhh- 81  Thermotoga maritima
1EUQ_A     29 HTRFPpepngylHIGHAKs-ICLNFgiaqdykgqCNLRFDDTnpvk--------ediEYVESIKNDvewlgfhwsgnvry 99  Escherichia coli
1N1D_A      3 KVITYgtf-dllHWGHIKl-LERAKqlg----dyLVVAISTDefnlqkqkkayhsyeHRKLILETIryvdevipeknwe- 75  Bacillus subtilis
1I6M_A      3 TIFSGiqpsgviTIGNYIgaLRQFVelqh--eynCYFCIVDQhaitvwq--dphelrQNIRRLAALylavgidptqatlf 78  Geobacillus stearo...
Feature 1                                                                                     
1IHO_A     96 keiypngtethtyvdvpg-------------------------------------------------------------- 113 Escherichia coli
1VLH_F        --------------------------------------------------------------------------------     Thermotoga maritima
1EUQ_A    100 ssdyfdqlhayaielinkglayvdeltpeqireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidm 179 Escherichia coli
1N1D_A        --------------------------------------------------------------------------------     Bacillus subtilis
1I6M_A     79 iqsevpahaqaawmlqcivyigel-------------------------------------------------------- 102 Geobacillus stearo...
Feature 1                                                                                     
1IHO_A    114 ----------------lstmlegasrpghfrgvstivsklfnlvqpdIACFGEkdfqqlalir-------kmvadmgfdi 170 Escherichia coli
1VLH_F     82 ----------------------------------gllvdylkkhgikVLVRGLravtdyeyelqm----alankklysdl 123 Thermotoga maritima
1EUQ_A    180 aspfivmrdpvlyrikfaehhqtgnkwciypmydfthcisdalegitHSLCTLefqdnrrlydw-----vldnitipvhp 254 Escherichia coli
1N1D_A     76 -----------------------------------qkkqdiidhnidVFVMGDdwegkfd--------------flkdqc 106 Bacillus subtilis
1I6M_A    103 ----------ermtqfkeksagkeavsaglltypplmaadillyntdIVPVGEdqkqhieltrdlaerfnkrygelftip 172 Geobacillus stearo...
Feature 1                          ####
1IHO_A    171 EIVgvpimra-----kdglalSSRN 190 Escherichia coli
1VLH_F    124 ETVfliase-------kfsfiSSSL 141 Thermotoga maritima
1EUQ_A    255 RQYefsrln------leytvmSKRK 273 Escherichia coli
1N1D_A    107 EVVylpr----------tegiSTTK 121 Bacillus subtilis
1I6M_A    173 EARipkvgarimslvdptkkmSKSD 197 Geobacillus stearothermophilus

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap