Conserved Protein Domain Family

cd01819: Patatin_and_cPLA2 
Click on image for an interactive view with Cn3D
Patatins and Phospholipases
Patatin-like phospholipase. This family consists of various patatin glycoproteins from plants. The patatin protein accounts for up to 40% of the total soluble protein in potato tubers. Patatin is a storage protein, but it also has the enzymatic activity of a lipid acyl hydrolase, catalyzing the cleavage of fatty acids from membrane lipids. Members of this family have also been found in vertebrates. This family also includes the catalytic domain of cytosolic phospholipase A2 (PLA2; EC hydrolyzes the sn-2-acyl ester bond of phospholipids to release arachidonic acid. At the active site, cPLA2 contains a serine nucleophile through which the catalytic mechanism is initiated. The active site is partially covered by a solvent-accessible flexible lid. cPLA2 displays interfacial activation as it exists in both "closed lid" and "open lid" forms.
PSSM-Id: 132836
Aligned: 13 rows
Threshold Bit Score: 71.6775
Threshold Setting Gi: 148255709
Created: 13-Dec-2003
Updated: 2-Oct-2020
Aligned Rows:
active sitenucleophile
Conserved site includes 5 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
  • Comment:catalytic dyad is formed by Ser and Asp
  • Comment:oxyanion hole is formed by two Gly and one Arg

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1              ## #                                     #                                 
1OXW_A         19 LSIDGGGIRGi-IPATILEFLegqlqexdnnadarladyfdvIGGTSTGGLLTAXIStpnennrpfaaakeivpfyfehg 97   heartleaf nig...
1CJY_A        192 ILGSGGGFRAmvGFSGVMKALyesgil----------dcatyVAGLSGSTWYMSTLYshpdfpekgpeeineelmknvsh 261  human
P41247          6 LSFAACGFLGi-YHLGAASALcrhgkkl--------vkdvkaFAGASAGSLVASVLLtapekieecnqfty--------- 67   human
YP_001240294  261 LAISGGGIRSatFALGVLVALarrnll----------fqfdyLSTVSGGGYIGAFMTtflssqfl--------------- 315  Bradyrhizobiu...
Q86XP0        325 IMATGGGARAmtSLYGHLLALqklgll----------dcvtyFSGISGSTWTMAHLYgdpewsqrdlegpiryarehlak 394  human
Q11121         99 VACSGGGYRAmlSGAGMLAAMdnrtdganehglggllqsttyLAGLSGGNWLVGTLAwnnwtsvqdivnnmteddsiwdi 178  Torulaspora d...
Q9UP65         46 VLGSGGGLRAhiACLGVLSEMkeqgll----------davtyLAGVSGSTWAISSLYtndgdmealeadlkhrftrqewd 115  human
CAG30362       10 LSFAGCGFLGf-YHVGATRCLsehaphl--------lrdarmLFGASAGALHCVGVLsgipleqtlqvlsd--------- 71   human
Q96AD5         10 ISFAGCGFLGv-YYVGVASCLrehapfl--------vanathIYGASAGALTATALVtgvclgeagakfie--------- 71   human
XP_970721       3 LSFAGCGFLGi-YHVGVACCFrkyaph----------lllnkISGASAGAIAACCLLldlplgettsdilr--------- 62   red flour beetle
Q8N8W4         16 ISFSGSGFLSf-YQAGAVDALrdlaprm--------letahrFAGTSAGAVIAALAIcgiemdeylrvlnv--------- 77   human
Q12043        183 LVLSGGSTFGl-FHIGVLAALfesdl------------mpkvISGSSAGAIVASIFCvhttqeipslltnvlnmefnifn 249  baker's yeast
Q6ZV29        928 LVLGGGGARGc-AQVGVLKALaecgi------------pvdmVGGTSIGAFVGALYSeernysqmrirakqwa------- 987  human
Feature 1                                                                                         
1OXW_A         98 pqifnpsg----------------------------------------qilgpkydgkylxqvlqeklgetrvhqalteV 137  heartleaf nig...
1CJY_A        262 nplllltpqkvkryveslwkk--------------kssgqpvtftdifgmligetlihnrmnttlsslkekvntaqcplP 327  human
P41247         68 -----------------------------------------------------------------kfaeeirrqsfgavT 82   human
YP_001240294  316 -----------------------------------------------------------------------ssettagpP 324  Bradyrhizobiu...
Q86XP0        395 sklevfsperlasyrrelelr--------------aeqghpttfvdlwalvlesmlhgqvmdqklsgqraalergqnplP 460  human
Q11121        179 snsiinpggfmivttikrwdhisdavegkqdagfnvsltdiwgralsynffpslyrggvaytwstlrdvevfqngempfP 258  Torulaspora d...
Q9UP65        116 lakslqktiqaarsen-------------------------ysltdfwaymviskqtrelpeshlsnmkkpveegtlpyP 170  human
CAG30362       72 ------------------------------------------------------------------lvrkarsrnigifH 85   human
Q96AD5         72 ------------------------------------------------------------------vskearkrflgplH 85   human
XP_970721      63 ------------------------------------------------------------------vatearrrslgpfN 76   red flour beetle
Q8N8W4         78 ------------------------------------------------------------------gvaevkksflgplS 91   human
Q12043        250 ddnskspnenll--------------------------------ikisrfcqngtwfnnqplintmlsflgnltfreayN 297  baker's yeast
Q6ZV29        988 ----------------------------------------------------------------egmtslmkaaldltyP 1003 human
Feature 1                                                                                         
1OXW_A        138 VISSFDikt----------------------------------------------------------------------- 146  heartleaf nig...
1CJY_A        328 LFTCLHvkpdvs-------------------------------------------------------------------- 339  human
P41247         83 PGYDFMarlrsgmesilp-------------------------------------------------------------- 100  human
YP_001240294  325 LGLLRDdlpfqredgeaaalrhvrhhskylatgsgverlqiafaqvygmvmnglgviylaaiaavveymlrlalppaafw 404  Bradyrhizobiu...
Q86XP0        461 LYLSLNvkennle------------------------------------------------------------------- 473  human
Q11121        259 ISVADGrypgtqi------------------------------------------------------------------- 271  Torulaspora d...
Q9UP65        171 IFAAIDndlqpswq------------------------------------------------------------------ 184  human
CAG30362       86 PSFNLSkflrqglckclp-------------------------------------------------------------- 103  human
Q96AD5         86 PSFNLVkiirsfllkvlp-------------------------------------------------------------- 103  human
XP_970721      77 PSFNIHsllleglekflp-------------------------------------------------------------- 94   red flour beetle
Q8N8W4         92 PSCKMVqmmrqflyrvlp-------------------------------------------------------------- 109  human
Q12043        298 KTGKILnitvsp-------------------------------------------------------------------- 309  baker's yeast
Q6ZV29       1004 ITSMFSgagfnssifsvf-------------------------------------------------------------- 1021 human
Feature 1                                                                                         
1OXW_A        147 --------------------------------------------------nkPVIFTKSnlans---------------- 160  heartleaf nig...
1CJY_A        340 ----------------------------------------------elmfadWVEFSPYeigmakygtfmapdlf----- 368  human
P41247        101 -----------------------------------------psahelaqnrlHVSITNAktrenhlvs------------ 127  human
YP_001240294  405 ptpvliagaallltpfvlpllwrrpahrsmadrlllvlclilivllawhglgWLHHNLRwhplylliplaplla------ 478  Bradyrhizobiu...
Q86XP0        474 ----------------------------------------------tldfkeWVEFSPYevgflkygafvppelf----- 502  human
Q11121        272 ----------------------------------------------idlnatVFEFNPFemgswdptlnaftdvkylgtk 305  Torulaspora d...
Q9UP65        185 ---------------------------------------------earapetWFEFTPHhagfpalgafvsithf----- 214  human
CAG30362      104 -----------------------------------------anvhqlisgkiGISLTRVsdgenvlvs------------ 130  human
Q96AD5        104 -----------------------------------------adshehasgrlGISLTRVsdgenviis------------ 130  human
XP_970721      95 -----------------------------------------ddahirvsgklHISLTRVhdgknvivs------------ 121  red flour beetle
Q8N8W4        110 -----------------------------------------edsykvttgklHVSLTRLtdgenvvvs------------ 136  human
Q12043        310 ----------------------------------------------asiyeqPKLLNNLtapn----------------- 326  baker's yeast
Q6ZV29       1022 ----------------------------------------kdqqiedlwipyFAITTDItasamrv-------------- 1047 human
Feature 1                                                                                         
1OXW_A        161 ------------peldaKXYDISYSTAAAptyfpphyfvt---------------------------------------- 188  heartleaf nig...
1CJY_A        369 -gskffmgtvvkkyeenPLHFLMGVWGSAfsilfnrvlgvsgsqsrgstmeeelenittkhivsndssdsddeshepkgt 447  human
P41247        128 --------tfssredliKVLLASSFVPIYaglklv--------------------------------------------- 154  human
YP_001240294  479 ---samlalsgrmaaplRILLYIVSWVALplvvvgaelii---------------------------------------- 515  Bradyrhizobiu...
Q86XP0        503 -gseffmgrlmrripepRICFLEAIWSNIfslnlldawydltssgeswkqhikdktrslekeplttsgtssrleaswlqp 581  human
Q11121        306 vsngepvnkgqcvagydNTGFIMGTSSSLfnqfllqinstslpsfiknlvtgflddlsede------------------- 366  Torulaspora d...
Q9UP65        215 -gskfkkgrlvrthperDLTFLRGLWGSAlgntevireyifdqlrnltlkglwrravanaksighlifarllrlqessqg 293  human
CAG30362      131 --------dfrskdevvDALVCSCFIPFYsglipp--------------------------------------------- 157  human
Q96AD5        131 --------hfnskdeliQANVCSGFIPVYcglipp--------------------------------------------- 157  human
XP_970721     122 --------qfdsreeliQALLATAFIPIFsgiipp--------------------------------------------- 148  red flour beetle
Q8N8W4        137 --------eftskeeliEALYCSCFVPVYcglipp--------------------------------------------- 163  human
Q12043        327 -------------vliwSAVCASCSLPGVfpstplfekdphtgk------------------------------------ 357  baker's yeast
Q6ZV29       1048 ----------htdgslwRYVRASMSLSGYmpplcd--------------------------------------------- 1072 human
Feature 1                                                                                         
1OXW_A            --------------------------------------------------------------------------------      heartleaf nig...
1CJY_A        448 enedagsdyqsdnqaswihrmimalvsdsalfntregragkvhnfmlglnlntsyplsplsdfatqdsfdddeldaavad 527  human
P41247            --------------------------------------------------------------------------------      human
YP_001240294      --------------------------------------------------------------------------------      Bradyrhizobiu...
Q86XP0        582 gtalaq------------------------------------afkgfltgrplhqrspnflqglqlhqdycshkdfstwa 625  human
Q11121        367 -------------------------------------------------------------------ddiaiyapnpfkd 379  Torulaspora d...
Q9UP65        294 ehpppedeggepehtwlte----------mlenwtrtslekqeqphedperkgslsnlmdfvkktgicaskwewgtthnf 363  human
CAG30362          --------------------------------------------------------------------------------      human
Q96AD5            --------------------------------------------------------------------------------      human
XP_970721         --------------------------------------------------------------------------------      red flour beetle
Q8N8W4            --------------------------------------------------------------------------------      human
Q12043            --------------------------------------------------------------------------------      baker's yeast
Q6ZV29            --------------------------------------------------------------------------------      human
Feature 1                              #                                                          
1OXW_A        189 --------ntsngdeyefnLVDGAVATvadpallsisvatrla------------------------------------- 223  heartleaf nig...
1CJY_A        528 pdeferiyepldvkskkihVVDSGLTFnlpypli---------------------------------------------- 561  human
P41247        155 -------------eykgqkWVDGGLTNalpil------------------------------------------------ 173  human
YP_001240294  516 ---------ydqldgntvlPVLGATSNifiagvlvaigfwlfcdlfdinftaphrhykkklaeaylvqpdpadplgplrq 586  Bradyrhizobiu...
Q86XP0        626 dyqldsmpsqltpkeprlcLVDAAYFIntsspsm---------------------------------------------- 659  human
Q11121        380 tsyiqdnfsksisesdylyLVDGGEDNqniplvpl--------------------------------------------- 414  Torulaspora d...
Q9UP65        364 lykhggirdkimssrkhlhLVDAGLAIntpfplv---------------------------------------------- 397  human
CAG30362      158 -------------sfrgvrYVDGGVSDnvpfi------------------------------------------------ 176  human
Q96AD5        158 -------------slqgvrYVDGGISDnlply------------------------------------------------ 176  human
XP_970721     149 -------------kfkgvrYMDGGYSDnlpt------------------------------------------------- 166  red flour beetle
Q8N8W4        164 -------------tyrgvrYIDGGFTGmqpca------------------------------------------------ 182  human
Q12043        358 ----ikewgatnlhlsnmkFMDGSVDNdmpis------------------------------------------------ 385  baker's yeast
Q6ZV29       1073 -------------pkdghlLMDGGYINnlpadv----------------------------------------------- 1092 human
Feature 1                               
1OXW_A        224 qkdpafasirslnykkXLLLSL 245  heartleaf nightshade
1CJY_A        562 ---------lrpqrgvDLIISF 574  human
P41247        174 ------------pvgrTVTISP 183  human
YP_001240294  587 nvsvplsscneagrgpYHLINC 608  Bradyrhizobium sp. BTAi1
Q86XP0        660 ---------frpgrrlDLILSF 672  human
Q11121        415 ---------vqdernvDVIFAL 427  Torulaspora delbrueckii
Q9UP65        398 ---------lpptrevHLILSF 410  human
CAG30362      177 ------------daktTITVSP 186  human
Q96AD5        177 ------------elknTITVSP 186  human
XP_970721     167 ------------ldenTITVSP 176  red flour beetle
Q8N8W4        183 ------------fwtdAITIST 192  human
Q12043        386 ------------rlseMFNVDH 395  baker's yeast
Q6ZV29       1093 ----------arsmgaKVVIAI 1104 human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap