2WTF


Conserved Protein Domain Family
PolY_Pol_eta

?
cd01702: PolY_Pol_eta 
Click on image for an interactive view with Cn3D
DNA Polymerase eta
Pol eta, also called Rad30A, is a translesion synthesis (TLS) polymerase. Translesion synthesis is a process that allows the bypass of a variety of DNA lesions. TLS polymerases lack proofreading activity and have low fidelity and low processivity. They use damaged DNA as templates and insert nucleotides opposite the lesions. Unlike other Y-family members, Pol eta can efficiently and accurately replicate DNA past UV-induced lesions. Its activity is initiated by two simultaneous interactions: the PIP box in pol eta interacting with PCNA, and the UBZ (ubiquitin-binding zinc finger) in pol eta interacting with monoubiquitin attached to PCNA. Pol eta is more efficient in copying damaged DNA than undamaged DNA and seems to recognize when a lesion has been passed, facilitating a lesion-dependent dissociation from the DNA.
Statistics
?
PSSM-Id: 176456
View PSSM: cd01702
Aligned: 15 rows
Threshold Bit Score: 420.952
Threshold Setting Gi: 71003135
Created: 6-Mar-2006
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
active siteDNA binding
Conserved site includes 13 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1           ### ##                              ##  #  #     #                           
2WTF_A        50 AHIDMNaFFAQVEQMRcgl-skEDPVVCVQWns-----iIAVSYAARKYGISRmDTIQEALKKCSnlipihtavfkkged 123 baker's yeast
EAL02297      50 ALIDLNaFFAQVEQIRlnl-tnQDPVVCAQWns-----vIAVSYASRKFGITRmDTIASCKSKCPnviiahaavykkges 123 Candida albican...
AAH77989      10 ALVDMDcFYVQVEQRMnpa-lkNKPVVVVQYktwkgggiIAVSYEARAFGVTRnMFADDAKKLCAdlqlarvr------- 81  African clawed ...
CAG81630      27 VHLDMDaFFAQVEQVRlgl-ppGTPVACRQWdg-----lIAVGYAARASGITRhMRAPEAQKLCPnlvmahaasfkrged 100 Yarrowia lipoly...
O42917        30 AHIDQDaFYAQVESVRlgl-dhSVPLAVQQWqg-----lIAVNYAARAANISRhETVTEAKKKCPelctahvktwkages 103 fission yeast
NP_001001304  10 ALVDMDcFFMQVEQRFdpr-lrGRPCAVVQYnqwqgggiIAVSYEARAFGVSRgMWATEARALCPelllarvp------- 81  chicken
AAS50502      27 AHIDVNaFFAQVEQVRcgy-gkDDPVVCVQWss-----vIAVSYACRKYGITRlDSVAEAMKKCPtlipihtavfkkged 100 Ashbya gossypii...
AAC79146      15 AHVDMDcFYVQVEQRKqpe-lrGLPSAVVQYnewqggglIAVSYEARKCGVKRsMRGDEAKAACPqiqlvqvp------- 86  thale cress
CAJ04143      18 AHMDMDcFYAQVEAVRlgvdcrVTPLVLSQWgs-----lIAVNYPARARGVRRfSNVSEAQALCPglivalspsyrmgea 92  Leishmania major
XP_451081     27 AHIDVNaFFAQVEQVRcgf-srDDPVVAVQWts-----iLAVSYAARKYNVSRmESILDAIKKCDkiipihtavfrkged 100 Kluyveromyces l...
Feature 1                                                                         ##             
2WTF_A       124 fwqyhdgcgswvqdpakqisvedhkvsLEPYRRESRKALKIFksa-----------cdlVERASIDEVFLDLgricfnml 192 baker's yeast
EAL02297     124 h----------wayveglpainkhkvsLDPYRRESRKILRVIgks-----------fdlTEKASVDECYIDLgreiykrl 182 Candida albican...
AAH77989      82 --------------------eahgkadLTHYREASVEVMEVMsrf------------avVERASIDEAYIDLtdsvqkrl 129 African clawed ...
CAG81630     101 m-----------weyhanpsaddykisLDPYRQAGKKVLNIVkqy-----------ssvVEKASVDESYLDLgprifnei 158 Yarrowia lipoly...
O42917       104 e-----------akyhenpnpnyyktcLDPYRHESVKILNIIkkh-----------apvVKKASIDECFIELtsdvkriv 161 fission yeast
NP_001001304  82 --------------------eargkadLTRYREASAEVMEVLsrf------------aaIERASIDEAYLDLtgsarerl 129 chicken
AAS50502     101 fwqyhdgygpwntdpsrqldpaihkvaLDPYRRESRKLLKMIqkr-----------cpiVEKASIDEVFVDLgpqcfaql 169 Ashbya gossypii...
AAC79146      87 --------------------vargkadLNLYRSAGSEVDGSGsyyytvcvvsilaksgkCERASIDEVYLDLtdaaesml 146 thale cress
CAJ04143      93 v-----------sqyhphpvqdsyklsLEPYRHASRQIFSILaatp----------gvqVEKGSVDEAYVDVteaarrel 151 Leishmania major
XP_451081    101 ywqyhdgcgswvedeskklsptnykvaLEPYRRESRKLIKLFqde-----------ydlVEKASVDEAFIELgrklfyel 169 Kluyveromyces l...
Feature 1                                                                                        
2WTF_A       193 mfdneyeltgdlklkdalsnireafiggnydi-----------------nshlplipekikslkfegdvfnpegrdlitd 255 baker's yeast
EAL02297     183 idlfpqlsrgsrdnpensyanlplippalp--------------------lnlkwegeiintekeksedndivsppvied 242 Candida albican...
AAH77989     130 remgvapisgellkntyvqgfpqcgmd--------------------------rdslskeelrrhgleqwleslpvgdph 183 African clawed ...
CAG81630     159 miafpqlqlldndldnflpapprahelkirgy-----------------nwdglgvleivtdvsrfdpdirvhddtmvtd 221 Yarrowia lipoly...
O42917       162 leeypylkipsedsnvalpqapvll-------------------------------wpaefgmvieeevvdrtkedyerd 210 fission yeast
NP_001001304 130 relrgrpleaellpttfvqglpaepgl---------------------------qpadkeelrrrglqewlaslsfdnvn 182 chicken
AAS50502     170 llgddgaefqelrrlfvegsysldepl--------------------------pplprsvklqfagdvygadaertsfld 223 Ashbya gossypii...
AAC79146     147 adappeslelideevlkshilgm-----------------------------------nredgddfkesvrnwicredad 191 thale cress
CAJ04143     152 aevraaaagasldpledvmepstrliedrraemeawlsargtslaavfdepmralvrgecgaelegsrafcvgaddaaya 231 Leishmania major
XP_451081    170 lmddsytdfadirgifqdgrydlndhl---------------------------pslptklsiqfsgevfnsqnrplfed 222 Kluyveromyces l...
Feature 1                                                      #                                 
2WTF_A       256 wddvilalGSQVCKGIRDSIKDILGYTTSCGLSsTKNVCKLASNYKKPDAQTIVKNDClldfldcgkfEITSFWTLGGVL 335 baker's yeast
EAL02297     243 wddicfiiGSQILLEVRKDIFEELGYTTSAGLArTKQVAKLAAGFKKPDAQTIIRNSAinsf--ltnfELTDVTGMGGKL 320 Candida albican...
AAH77989     184 sadvklavGAIIVEEMRAAVEEETTFQCSAGIAhNKVLAKLACGLNKPNRQTILCQGSvpgl--fselPIGKIRHLGGKL 261 African clawed ...
CAG81630     222 wddlvlmfGARISKRMREQVYEELKYTCSAGIArCRSVAKLASAQNKPNNQTVVRAGAlnny--lkkkSLTDIGGMGGKL 299 Yarrowia lipoly...
O42917       211 wddvflfyAAKIVKEIRDDIYLQLKYTCSAGVSfNPMLSKLVSSRNKPNKQTILTKNAiqdy--lvslKITDIRMLGGKF 288 fission yeast
NP_001001304 183 cpdlqlamGAVIVEEIRVAVEKATGFRCSAGIShNKMLAKLACGLNKPNRQTLVSSRSvpql--fsqmPVSSIRNLGGKL 260 chicken
AAS50502     224 wddvimclGSRLALALRQEVEDALGYTTSCGVSrTKSVSKLASNYRKPNAQTIVRNAAvetfldqggfELPSFWTLGGAI 303 Ashbya gossypii...
AAC79146     192 rrdkllscGIIIVAELRKQVLKETEFTCSAGIAhNKMLAKLASGMNKPAQQTVVPYAAvqel--lsslPIKKMKQLGGKL 269 thale cress
CAJ04143     232 erclllcaASRVVHRLRQRIYAELHYDCSAGIAhNRVLAKCISATHKPNQQTLLLPDRsasa--lfelPLSGLRGFGGKL 309 Leishmania major
XP_451081    223 wddvlmclASNSTNTIRNQIDDMLGYTTSCGISmTKNLSKLASNYKKPNAQTIVKNNCiddfldcgkfEINSFWTLGGIR 302 Kluyveromyces l...
Feature 1                                                                                        
2WTF_A       336 GKELIDVLDlphensikhiretwpdnagqlke------------------fldakvkqsdydrstsnidplktADLAEKL 397 baker's yeast
EAL02297     321 GESIINKVNvppqinsisfire---------------------------------------nfsdasikeklgGELGLKV 361 Candida albican...
AAH77989     262 GTSIKEILDveyigqltqf--------------------------------------------tvqhlqnhfgDKTGSWL 297 African clawed ...
CAG81630     300 GEEVLEKLGldkeskdnitqvq--------------------------------------alskqqlqqklqnASLTEKV 341 Yarrowia lipoly...
O42917       289 GEEIINLLGtdsikdvwnm--------------------------------------------smdflidklgQTNGPLV 324 fission yeast
NP_001001304 261 GVAITDILGveyigevtkf--------------------------------------------semelqthfgDKTGSWL 296 chicken
AAS50502     304 GKELLDLLElppagsipalralcpespeqlhac----------------llrrirdrplphdaapylideqaaEALATKL 367 Ashbya gossypii...
AAC79146     270 GTSLQTDLGvdtvgdllqf--------------------------------------------setklqehygVNTGTWL 305 thale cress
CAJ04143     310 GAAVSAVCGgvtecreawlvplaqlrkldgtcdvgdgedaegdregrkrrpiarkrgraasaslerdlqglvaHTTSLYV 389 Leishmania major
XP_451081    303 GKELIDLMElpkehsikfirdswpvssddirkf-----------------mlkkiicrdiqrsreynineadvAKISAKI 365 Kluyveromyces l...
Feature 1                                                                                        
2WTF_A       398 FKLSRGryglplssrpvvKSMMSNKNLRGKscnsi-vdciSWLEVFCAELTSRiqdleq-------------eynkivIP 463 baker's yeast
EAL02297     362 YNIVRGinaielqstievKSMTSTKNFTSFvisnl-fdayDWLKVFAGDLHNRlidldnenmelsstelsnkskgimkRP 440 Candida albican...
AAH77989     298 YSLCRGiedepvkprqlpKSIGCSKNFPGKtslstreqvqYWLLQLSLELEGRlqkdr---------------dannrVA 362 African clawed ...
CAG81630     342 FNLARGnlyrglktrielKSMLSAKNFARVplkdr-keaeLWLVVFAGELAMRivehek-------------elgtcrRP 407 Yarrowia lipoly...
O42917       325 WNLCHGidnteittqvqiKSMLSAKNFSQQkvkse-edaiNWFQVFASDLRSRflel-----------------egmrRP 386 fission yeast
NP_001001304 297 YDLCRGiddepvknrhlpQSIGCSKNFPGKtalatqkevqHWLLQLALELESRlikdr---------------sqnhrVA 361 chicken
AAS50502     368 FYLVRGthcvpvnprptvSSMTSRKNMRGNacksl-adchPWLEVFSAELAGRlqdlhq-------------eydriyLP 433 Ashbya gossypii...
AAC79146     306 WNIARGisgeevqgrllpKSHGSGKTFPGPralkslstvqHWLNQLSEELSERlgsdl---------------eqnkrIA 370 thale cress
CAJ04143     390 FYRLRGlaedtilnrplsKTIIASKNFGRIttsv--emvrRWIIVLTSELCSRyeeft---------------alyqiRG 452 Leishmania major
XP_451081    366 YQLVRGqfrlpveprplpKSMMSKKNLRNDdcasv-idciEWLEIFCSELNYRvhdleq-------------eyekviMP 431 Kluyveromyces l...
Feature 1                                                                                        
2WTF_A       464 RTVSISLKTks------------yeVYRKSGPVaykg----infQSHELLKVGIKFVTDLdikgkn------ksyypLTK 521 baker's yeast
EAL02297     441 KTLTLGVLSkn------------gtRQTRQMQIp----------IHKDLDKMKDIFFENGcvllref----lefnthISL 494 Candida albican...
AAH77989     363 KLLTVGLNQmgkr---------lygSMSRCCALtryd----aqkISSDAFVLLKSFNAAGmhqaa--------wsppLTL 421 African clawed ...
CAG81630     408 RTVSLQHARfkp-----------mvKRSRQQDLplvhtnklkeeLFAAGVKLLKLIENEPehd-----------aypISM 465 Yarrowia lipoly...
O42917       387 KTICLTVVSrf-------------lRKSRSSQIpmnvd-istqfIVEATSKLLRQLQQEFdv-------------ypISN 439 fission yeast
NP_001001304 362 KQLMVVIRMqg------------dtRLSRFCAVtryd----aqkIFNDAFALIQNCNMAGahqaa--------wsppLIS 417 chicken
AAS50502     434 RTLTVAAQGra------------hqRVSRSTGLhaptgnvtaltLLKAGARLVNELDERFcgad----------mypLSA 491 Ashbya gossypii...
AAC79146     371 STLTLHASAfrvptslskdsdshkkFPSKSCPMryg-----vtkIQEDAFNLFQAALREYmgsfgikpqgnkletwrITG 445 thale cress
CAJ04143     453 RSFNIKLGNdgfr--------stggLSSHTVALpeam---qpdiLAAVAMREVQAVFRNKpgaa----------adsVTL 511 Leishmania major
XP_451081    432 RTIVIMIKGkagm--------kytqTRRITTASssit----sreLFINATKLINEIDKQHgkla---------gvypLRE 490 Kluyveromyces l...
Feature 1               
2WTF_A       522 LSMTITN 528 baker's yeast
EAL02297     495 LNNRTPA 501 Candida albicans SC5314
AAH77989     422 LQLSASK 428 African clawed frog
CAG81630     466 LSLSVTG 472 Yarrowia lipolytica CLIB99
O42917       440 LSISFQN 446 fission yeast
NP_001001304 418 VHLAASK 424 chicken
AAS50502     492 LSMSLAN 498 Ashbya gossypii ATCC 10895
AAC79146     446 LSVSASK 452 thale cress
CAJ04143     512 TIGGFVS 518 Leishmania major
XP_451081    491 LSLTLSN 497 Kluyveromyces lactis NRRL Y-1140

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap