1H16


Conserved Protein Domain Family
PFL1

?
cd01678: PFL1 
Click on image for an interactive view with Cn3D
Pyruvate formate lyase 1
Pyruvate formate lyase catalyzes a key step in anaerobic glycolysis, the conversion of pyruvate and CoenzymeA to formate and acetylCoA. The PFL mechanism involves an unusual radical cleavage of pyruvate in which two cysteines and one glycine form radicals that are required for catalysis. PFL has a ten-stranded alpha/beta barrel domain that is structurally similar to those of all three ribonucleotide reductase (RNR) classes as well as benzylsuccinate synthase and B12-independent glycerol dehydratase.
Statistics
?
PSSM-Id: 153087
View PSSM: cd01678
Aligned: 13 rows
Threshold Bit Score: 1243.02
Threshold Setting Gi: 3122593
Created: 1-Sep-2004
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 10 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                     
1H16_A     10 AWEGFTKGDWQNEVNVRDFIQKNYTPYEGDESFLAGATEATTTLWDKVMEGvklen-rthapVDFDTAVASTITSHDAGY 88  Escherichia coli
Q46266      4 QWEGFQDGEWTNDVNVRDFIQKNYKEYTGDKSFLKGPTEKTKKVWDKAVSLileel--kkgiLDVDTETISGINSFKPGY 81  Clostridium pasteu...
O32799     13 AWDGFKGTNWRDKASVTRFVQENYKPYDGDESFLAGPTERTLKVKKIIEDTknhy---eevgFPFDTDRVTSIDKIPAGY 89  Lactococcus lactis...
CAA76352   65 APCITNDAAAKSEIDVEGWIKKHYTPYEGDGSFLAGPTEKTKKLFAKAEEYlaker-angglYDVDPHTPSTITSHKPGY 143 Piromyces sp. E2
AAF18275   30 PWRGFKGRKWQREIDTRDFILSNVTSYTGNSDFLAGITPKTTKLWEKLQVSleaerktqggvLDVDTSTVSNITAHAPGF 109 Zymomonas mobilis
NP_681780  17 AWQEFTGGDWVERIDVRDFIQRNYTPYTGDGSFLVGASDRTQQLWAKVRDLmaler--ekgvLDADTSLPSSITAHPPGY 94  Thermosynechococcu...
NP_786563  12 AWKGFKGGHWQEEINIRDFIQNNFTQYNGDESFLAGPTAATKTLNDKVLELkkqer-aaggvLDADTKVVATITSHGPGY 90  Lactobacillus plan...
NP_813649   3 LNKIFKDGLWSSEINVRDFVSHNITPYYGDASFLEGPTERTKAVWNRCLEAlaeer-enngvRSLDNVTVSTITSHKAGY 81  Bacteroides thetai...
NP_815326   3 QWEGFKGDKWRTSVDTRDFIQNNYTEYKGDDSFLEPIAPSTDKLWTKLQELfeiqh-ekngvYDMDSDIPATITSHEPGY 81  Enterococcus faeca...
NP_696127  31 AWAGFTEGNWQKDIDVRDFIQKNYTPYEGDETFLAPATEKTKHLWKYLDDNylave-rkqrvYDVDTHTPADVDAFPAGY 109 Bifidobacterium lo...
NP_471365   4 AWDGFKGTAWQENISVGQFVQDNYTPYDGDESFLEKSTPRTTKLNEKINKLveemd-akggvLDMDNAIVSNVASHKAGY 82  Listeria innocua C...
YP_017128  11 AWENFKGEKWKAEIDVRDFILNNVNVYEGDESFLAGATEATKQLWDQVMDLttker-enggvLDMDTKIVSSITSHEPGY 89  Bacillus anthracis...
AAL94468    3 AWRGFKSGEWQNSINVSDFIKHNYTEYLGDESFLEGPTENTKKLWDILSGMlkier--ekgiYDAETKTPSKIDAYGAGY 80  Fusobacterium nucl...
Feature 1                                                                                     
1H16_A     89 IN---KQLEKIVGLQTEAPLKRALIPFGGIKMIEGSCKAYNRELDPMIKKIFTEYRKTHNQGVFDVYTPDILRCRKSGVL 165 Escherichia coli
Q46266     82 LD---KDNEVIVGFQTDAPLKRITNPFGGIRMAEQSLKEYGFKISDEMHNIFTNYRKTHNQGVFDAYSEETRIARSAGVL 158 Clostridium pasteu...
O32799     90 IDandKELELIYGMQNSELFRLNFMPRGGLRVAEKILTEHGLSVDPGLHDVLSQTMTSVNDGIFRAYTSAIRKARHAHTV 169 Lactococcus lactis...
CAA76352  144 LD---KDNEVIYGYQTDVPLKRAIKPFGGVNMVKNALKAVNVPMDKEVEHIFTDYRKTHNTAVFDLYSKEMRSGRSNAIM 220 Piromyces sp. E2
AAF18275  110 IE---KDLEVVVGLQTDAPLKRAIMPFGGYRMVKKGLEAYGFKEDESLSKIFPALRKTHNDGVFDVYTPEIMACRRSGII 186 Zymomonas mobilis
NP_681780  95 ID---RELEQIVGLQTDKPLKRAIMPFGGIRVVETALKAYGYELDPRTKEIFTKYRKTHNDGVFDAYTPEMRRCRKSGII 171 Thermosynechococcu...
NP_786563  91 IQ---KDLEKIVGLQTDKPLKRAFMPFGGIRMADDALKSYGYTPDEENDKIFTEYRKTHNQGVFDVYTPDMRKARHYKII 167 Lactobacillus plan...
NP_813649  82 ID---KENELIVGLQTDELLKRAIKPFGGINVVSKACHENGVEVDDRVKDIFTHYRKTHNDGVFDVYTEEIRSFRSLGFL 158 Bacteroides thetai...
NP_815326  82 LI---KEEEKIVGLQTDVPLKQAFMPFGGIKMANNALVSNGYETDEEMTKIFTEYRKTHNQGVFDAYTAEMRLARKNKII 158 Enterococcus faeca...
NP_696127 110 IDs-pEVDNVVVGLQTDVPCKRAMMPNGGWRMVEQAIKEAGKEPDPEIKKIFTKYRKTHNDGVFGVYTKQIKVARHNKIL 188 Bifidobacterium lo...
NP_471365  83 VD---KENEVIVGLQTDKPFKLAFMPNGGLRTAEQCLTDNGYSIDQELHDFYVKNRSTANDGIFRAYTDDIKRARHSHIV 159 Listeria innocua C...
YP_017128  90 LN---KETEKVVGFQTDKPFKRSLQPYGGIRMAEQACESYGYEMDKELSRIFRDWRKTHNQGVFDAYTPEMRAARKSGVI 166 Bacillus anthracis...
AAL94468   81 IS---KDLETIVGLQTDAPLKRAIFPNGGLRMVESSLEAFGYKLDPTTKEIYEKYRKSHNAGVFSAYTPAIKAARHTGVI 157 Fusobacterium nucl...
Feature 1               #                                                                     
1H16_A    166 TGLPDAYGRGRIIGDYRRVALYGIDYLMKDKLAQFTSLqadleng-vnleqtIRLREEIAEQHRALGQMKEMAAKYGYDI 244 Escherichia coli
Q46266    159 TGLPDAYGRGRIIGDYRRVALYGIDFLIQEKKKDLSNLkgdm------ldelIRLREEVSEQIRALDEIKKMALSYGVDI 232 Clostridium pasteu...
O32799    170 TGLPDAYSRGRIIGVYARLALYGADYLMKEKAKEWDAItein-------ddnIRLKEEINMQYQALQEVVNFGALYGLDV 242 Lactococcus lactis...
CAA76352  221 TGLPDGYGRGRIIGDYRRVALYGTDRLIAQKNKDKAELqkrqm-----deptMKLIGEVADQVKALKQLTQMAKSYGIDI 295 Piromyces sp. E2
AAF18275  187 TGLPDAYGRGRIIGDYRRVALYGVDCLIEHKKEQGKRLernpf-----deetIKLREEVAEQIKALHELAAMAKSYGYDI 261 Zymomonas mobilis
NP_681780 172 TGLPDAYGRGRIIGDYRRVPLYGVDRLIADKQAQQASLevdvm-----deetIRLREELSEQIKALNELKDMAASYGFDI 246 Thermosynechococcu...
NP_786563 168 TGLPDAYARGRLIPDLPRVAVYGIDRLMEDKANDFAHIgdgel-----tddvIRLREEVQDQYRALADMKKMAASYGYDI 242 Lactobacillus plan...
NP_813649 159 TGLPDNYARGRIIGDYRRMALYGIDRLIEAKKEDLHNLtgpm------tdarIRLREEVAEQIKALKDMKVMGEYYGLDL 232 Bacteroides thetai...
NP_815326 159 TGLPDAYGRGRIIGDYRRIALYGIDYLMEQKKKDHDNTgnkem-----tddvIRLREEISEQYRALNDLKQMAASYGFDI 233 Enterococcus faeca...
NP_696127 189 TGLPDAYGRGRIIGDYRRVALYGVNKLIAFKKRDKDSVpyrndftepeiehwIRFREEHDEQIKALKKLINLGNEYGLDL 268 Bifidobacterium lo...
NP_471365 160 SGLPDAYSRGRIIGLYQKPALYGVDRLIAEKQQDLKKIaiss-------denIRLREEIWLQIKALKDLIVLGNEYGLEL 232 Listeria innocua C...
YP_017128 167 TGLPDAYGRGRIIGDYRRVALYGVDHLIEAKKADLNLTggvm------sedtMRLREELSEQIRALQELKQMAASHGFDI 240 Bacillus anthracis...
AAL94468  158 TGLPDAYGRGRIIGDYRRVALYGVDRLIEERKREFDAYdpeem-----tedvIRDREEMFEQLEALKALKRMAAAYGFDI 232 Fusobacterium nucl...
Feature 1                                ##                                                   
1H16_A    245 SGPATNAQEAIQWTYFGYLAAVKSQNGAAMSFGRTSTFLDVYIERDLKAGKITEQEAQEMVDHLVMKLRMVRFLRTPEYD 324 Escherichia coli
Q46266    233 SRPAVNAKEAAQFLYFGYLAGVKENNGAAMSLGRTSTFLDIYIERDLEQGLITEDEAQEVIDQFIIKLRLVRHLRTPEYN 312 Clostridium pasteu...
O32799    243 SRPAMNVKEAIQWVNIAYMAVCRVINGAATSLGRVPIVLDIFAERDLARGTFTEQEIQEFVDDFILKLRTMKFARAAAYD 322 Lactococcus lactis...
CAA76352  296 SKPAKNAREATQFVYFGYLGSIKEQDGAAMSLGRVDAFLDCFFENDLKNGVITEAEAQEIIDNLILKLRFARHLRTPEYN 375 Piromyces sp. E2
AAF18275  262 SQPAVTAQQAVQWTYFAYLAAVKEANGAAMSLGRVSTFLDIYIERDLKEGRITEAEAQELVDQFVMKLRIVRFLRTPEYD 341 Zymomonas mobilis
NP_681780 247 SRPAANGKEAIQWLYFGYLAAVKEQNGAAMSLGRVSTFLDIYFERDLRHGTATEADIQEWIDHFVMKLRMVRFLRTPEYN 326 Thermosynechococcu...
NP_786563 243 SKPATNAQEAIQWMYFAYLAAIKTQNGAAMSVGRIDTTMDIFIQRDLDNGVLDESQAQELIDQFVMKLRMVRFIRTEEYN 322 Lactobacillus plan...
NP_813649 233 SRPAYTAQEAVQWVYMAYLAAVKEQDGAAMSLGNVSSFLDIYLEYELSKGTITESFAQELIDQFVIKLRMVRHLRMQSYN 312 Bacteroides thetai...
NP_815326 234 SRPAANAQEAIQWLYFGYLGAIKSQNGAAMSIGRISAFLDIYIQRDLEAGLITEFEAQEMIDHLIMKLRMVKFARTPEYN 313 Enterococcus faeca...
NP_696127 269 SRPAQTAQEAVQWTYMGYLASIKSQDGAAMSFGRNSAFLDCYIERDLQAGKITETDAQELIDNIVMKLRIVRFLRTKDYD 348 Bifidobacterium lo...
NP_471365 233 GRPAENATEAVQWTYMGYLASIKQANGAASSFGRIPIFLDIYIQRDLEKGIITEFDAQELIEQLTLKLRMVRFARTDGYN 312 Listeria innocua C...
YP_017128 241 SKPATNAQEAFQWLYFAYLAAIKEQNGAAMSLGRTSTFLDIYIERDLANGTLTEEDVQEIVDHFIMKLRLVKFARTPDYN 320 Bacillus anthracis...
AAL94468  233 GRPAETAQEAIQWTYFGYLGAIKDQNGAAMSLGKTAGFLDVYIERDLKEGRITEKQAQEFIDHFIMKLRIVRFLRTPEYD 312 Fusobacterium nucl...
Feature 1       #     #                                                                       
1H16_A    325 ELFSGDPIWATESIGGMGLDGRTLVTKNSFRFLNTLYTM--GPSPEPNMTILWSEKLPLNFKKFAAKVSIDTSSLQYEND 402 Escherichia coli
Q46266    313 ELFAGDPTWVTESIAGVGIDGRSLVTKNSFRYLHTLINL--GSAPEPNMTVLWSENLPESFKKFCAEMSILTDSIQYEND 390 Clostridium pasteu...
O32799    323 ELYSGDPTFITTSMAGMGNDGRHRVTKMDYRFLNTLDTI--GNAPEPNLTVLWDSKLPYSFKRYSMSMSHKHSSIQYEGV 400 Lactococcus lactis...
CAA76352  376 DLFAGDPTWVTMSLGGMGSDGRTLVTKTSFRVLNTLYNL--GPAPEPNITVLWNKALPKNFKDFATKVSIDTSSIQYESD 453 Piromyces sp. E2
AAF18275  342 QLFSGDPTWVTESLGGMAIDGRTLVTKSSFRFLHTLENL--GPAPEPNLTVLWSENLPKGFKDYCAKISIDTSSIQYEND 419 Zymomonas mobilis
NP_681780 327 ELFSGDPTWVTESIGGMGLDGRPLVTKTSFRILNTLYTL--GPAPEPNLTVLWSENLPEAFKRFCAQVSIDTSSIQYEND 404 Thermosynechococcu...
NP_786563 323 SLFSGDPIWATLSMCGLGVDGQHHVTKTAFRILKTLDNM--GAAPEPNITILWSDRLPEDFKRYATEVSIDSSTIQYEND 400 Lactobacillus plan...
NP_813649 313 DIFAGDPTWVTESLGGRLNDGRTKVTKTSFRFLQTLYNL--GPSPEPNLTVLWSPELPEGFKEFCAKVSIDTSSIQYEND 390 Bacteroides thetai...
NP_815326 314 QLFSGYPIWATLSIAGMGIDGRSLVTKNDFRILHTLTNM--GPSPEPNLTVLYSSHLPEGFRTYAAKIAKESSSIQFEND 391 Enterococcus faeca...
NP_696127 349 SIFSGDPYWATWSDAGFGDDGRSMVTKTSFRLLNTLTLEhlGPGPEPNITIFWDPKLPEAYKRFCAKISIDTSAIQYESD 428 Bifidobacterium lo...
NP_471365 313 ELYASNPTFVTTSMAGMGADGRHRVTKTDYRFLHCLDNL--GNSAEPNLTVLWDARLPESFKEYCMKMSVKHSSIQYEND 390 Listeria innocua C...
YP_017128 321 ELFSGDPTWVTESIGGMALDGRPLVTKNSFRFLHTLDNL--GPAPEPNLTVLWSKQLPQNFKNYCAKMSIKTSAIQYEND 398 Bacillus anthracis...
AAL94468  313 QLFSGDPVWVTESIGGMNNDGKSWVTKNAYRYLNTLYNL--GTAPEPNLTILWSERLPENWKKFCSKVSIDTSSLQYEND 390 Fusobacterium nucl...
Feature 1                    #                     #  #                                       
1H16_A    403 DLMRPDFnnDDYAIACCVSPMIVGk--------QMQFFGARANLAKTMLYAINGGVDEKlk-----mqVGPKSEPIKGDV 469 Escherichia coli
Q46266    391 DIMRPIYg-DDYAIACCVSAMRVGk--------DMQFFGARCNLAKCLLLAINGGVDEKkg-----ikVVPDIEPITDEV 456 Clostridium pasteu...
O32799    401 ETMAKDGygEMSCISCCVSPLDPEnee---grhNLQYFGARVNVLKAMLTGLNGGYDDVhk-----dyKVFDIEPVRDEI 472 Lactococcus lactis...
CAA76352  454 ALMSARFg-DDYGIACCVSAMRIGk--------DMQFFGARCNLAKLMLYVLNHGKDERtg-----kqVGPDFGPVPEGP 519 Piromyces sp. E2
AAF18275  420 DLMRSYWg-DDYGIACCVSAMRIGk--------QMQFFGARANLAKTLLYAINGGRDDKsg-----vqVAPAFAPVTGDI 485 Zymomonas mobilis
NP_681780 405 DLMRPYWg-DDYAIACCVSAMRVGk--------QMQFFGARVNLAKALLYAINGGRDEVsg-----qqVAPMFAPITGDT 470 Thermosynechococcu...
NP_786563 401 DLMRVQWgtDYYGIACCVSAQPIAd--------GIQYFGARANLAKAILYAINGGRDEIag-----dqVGPAYEPITSEY 467 Lactobacillus plan...
NP_813649 391 DLMREVRqsDDYGIACCVSYQEIGk--------QIQFFGARCNLAKALLLAINGGRCENtg-----tvMVKNIPVLTSDT 457 Bacteroides thetai...
NP_815326 392 DLLRENWgsDDCAIACCVSATVMGk--------DMQFFGARANLAKAVLYAINGGVDEKtk-----mqVAPKYRPMTGDK 458 Enterococcus faeca...
NP_696127 429 KEIRSHWg-DDAAIACCVSPMRVGk--------QMQFFAARVNSAKALLYAINGGRDEMtgmqvidkgVIEPITPEADGT 499 Bifidobacterium lo...
NP_471365 391 KLMQEEGygDMQCISCCVSPLNPEadkdkgethNLQYFGARVNVLKCLLGAINGGKDDLhk-----nqVFDVVEPITTEY 465 Listeria innocua C...
YP_017128 399 DIMRADYg-DDYGIACCVSAMRIGk--------QMQFFGARANLAKALLYAINGGKDEKsk-----aqVGPEYAPITSEV 464 Bacillus anthracis...
AAL94468  391 DIMRPQFg-EDYGIACCVSPMAIGk--------QMQFFGARANLPKALLYAINGGKDELkkd---qvtPAGQFERITSDY 458 Fusobacterium nucl...
Feature 1                                                                                     
1H16_A    470 LNYDEVMERMDHFMDWLAKQYITALNIIHYMHDKYSYEASLMALHDRDVIRTMACGIAGLSVAADSLSAIKYAKVKPIRD 549 Escherichia coli
Q46266    457 LDYEKVKENYFKVLEYMAGLYVNTMNIIHFMHDKYAYEASQMALHDTKVGRLMAFGIAGFSVAADSLSAIRYAKVKPIRE 536 Clostridium pasteu...
O32799    473 LDYDTVMENFDKSLNWLTDTYVDAMNIIHYMTDKYNYEAVQMAFLPTKVRANMGFGICGFANTVDSLSAIKYAKVKTLRD 552 Lactococcus lactis...
CAA76352  520 IPFDWMWETYDKAMDWIAKLYVNTMNVIHFCHDQYCYESLQMALHDTDVRRLMAFGVAGLSVVADSFSAIKYAKVTPVRD 599 Piromyces sp. E2
AAF18275  486 LDYEDVKSRMVQMMEWLSSVYINALNAIHFMHDKYMYERVEMALHDLEILRTMACGIAGLSVAADSLSAMKHAKVKIIRD 565 Zymomonas mobilis
NP_681780 471 LKWEEVLPRFEQMMAWLAKVYVNTLNVIHYMHDKYCYERLEMALHDRDVFRTMACGVAGLSVVADALSAIKYAEVKVIRN 550 Thermosynechococcu...
NP_786563 468 IDYDEFMKKLDKQMDWLADTYVNSLNAIHYMHDKYYYEAAQLALKNTDLDRTFATGISGLSHAADSISAIKYGHVKVIRD 547 Lactobacillus plan...
NP_813649 458 LKFEEVMDNYKKVLIEIARVYNEAMNIIHYMHDKYYYEKAQMALVDTNPRINLAYGVAGLSIALDSLSAIKYAKVTARRN 537 Bacteroides thetai...
NP_815326 459 LDYHEFMERYKDILDWLAELYVNTLNIIHYMHDKYAYEAPQLALMDTDLQRTFATGIAGISHATDSIMAIKHGEVEVIRD 538 Enterococcus faeca...
NP_696127 500 LDYEKVKNNYEKALEWLSETYVMALNIIHYMHDKYAYESIEMALHDKEVYRTLGCGMSGLSIAADSLAAVKYAKVYPIYN 579 Bifidobacterium lo...
NP_471365 466 LEYDEVLDKFDKSMDWLTDTYVDAMNIIHFMTDKYNYESMQMAFLPSKVTANMGFGICGFANVVDSLSAIKYAKVKTIRD 545 Listeria innocua C...
YP_017128 465 LDYEEVMHKFDMTMEWLAGLYLNTLNVIHYMHDKYSYERIEMALHDTNVLRTMATGIAGLSVVADSLSAIKYAKVKPIRD 544 Bacillus anthracis...
AAL94468  459 LDFDEVWEKYDKMLTWLASTYIKALNIIHYMHDKYSYEALEMALHSLDIKRTEACGIAGLSIVADSLAAIKYGKVRVIRD 538 Fusobacterium nucl...
Feature 1                                                                            # #      
1H16_A    550 Ed-----------------GLAIDFEIEGEYPQFGNNDPRVDDLAVDLVERFMKKIQKLHTYRDAIPTQSVLTITSNVVY 612 Escherichia coli
Q46266    537 N------------------GITVDFVKEGDFPKYGNDDDRVDSIAVEIVEKFSDELKKHPTYRNAKHTLSVLTITSNVMY 598 Clostridium pasteu...
O32799    553 En-----------------GYIYDYEVEGDFPRYGEDDDRADDIAKLVMKMYHEKLASHKLYKNAEATVSLLTITSNVAY 615 Lactococcus lactis...
CAA76352  600 Ak----------------tGLTVDFKIEGEFPKFGNDDDRVDFFARTVTDKLINKLRKTPTYRGATHTLSILTITSNVVY 663 Piromyces sp. E2
AAF18275  566 Er-----------------GLATDFKIEGDYPAYGNNDDRADEIAIWLVETFMNMLRKQTTYRRSVPTQSILTITSNVVY 628 Zymomonas mobilis
NP_681780 551 Ad-----------------GLAVDYEIKGDFPKYGNNDDRVDSLAVWVVETFMNEVRKHKTYRNAVPTQSILTITSNVVY 613 Thermosynechococcu...
NP_786563 548 Er-----------------GIAVDFKADNDYPRYGNNDDRADDIAKWLVKELYSKMNTHHLYRNAKLSTSVLTITSNVVY 610 Lactobacillus plan...
NP_813649 538 Di-----------------GLTEGFDIEGEFPCFGNDNDKVDHLGVDLVYFFSEELKKLPVYKNARPTLSLLTITSNVMY 600 Bacteroides thetai...
NP_815326 539 Ed-----------------GMAIDYVPTKEFPTYGNDNEEADAMANWILDYFMTQIKRQHTYRNSKPTTSLLTITSNVVY 601 Enterococcus faeca...
NP_696127 580 KdaktlegheyeyvegaddDLIVGYRTEGEFPVYGNDDDRADDIAKWVVSTVMGQVKRLPVYRGAVPTQSILTITSNVEY 659 Bifidobacterium lo...
NP_471365 546 Ed-----------------GFVYDYEVEGDFPRYGENDDRADDIAVMVLKMFKDKLDSHKLYKDSEATVSVLTITSNVAY 608 Listeria innocua C...
YP_017128 545 En-----------------GIAVDFEIEGDFPKYGNNDDRVDEIAVNLVKTFMNKLRKHKTYRNSVHTMSILTITSNVVY 607 Bacillus anthracis...
AAL94468  539 Ea-----------------GDAVDYVVEQPYVPFGNNDDRTDELAVKVVRTFMNKIRSHKMYRDAEPTQSVLTITSNVVY 601 Fusobacterium nucl...
Feature 1                                                                                     
1H16_A    613 GKKTGNTPDGR------------RAGAPFGPGANPMHg-----RDQKGAVASLTSVAKLPFAYAKDGISYTFSIVPNALG 675 Escherichia coli
Q46266    599 GKKTGTTPDGR------------KVGEPLAPGANPMHg-----RDMEGALASLNSVAKVPYVCCEDGVSNTFSIVPDALG 661 Clostridium pasteu...
O32799    616 SKQTGNSPVHKgvflnedgtvnkSKLEFFSPGANPSN------KAKGGWLQNLRSLAKLEFKDANDGISLTTQVSPRALG 689 Lactococcus lactis...
CAA76352  664 GKKTGSTPDGR------------KAGQPFAPGCNPMHg-----REFSGAVASLSSVAKVNYDSCMDGISNTFSIVPNTIG 726 Piromyces sp. E2
AAF18275  629 GKKTGNTPDGR------------RAGEPFAPGANPMHg-----RDLKGPVASMASVAKLPYAHAQDGISNTFTIVPNALG 691 Zymomonas mobilis
NP_681780 614 GKKTGSTPDGR------------KAGEPFAPGANPMHg-----RDTKGAIASLASVAKLPYVHAQDGISNTFSIVPSALG 676 Thermosynechococcu...
NP_786563 611 GKNTGTTPNGR------------QKGEPFSPGANPAYg-----AEKSGALASLLSTAKLPYRYATDGISNTFGVTPNTLG 673 Lactobacillus plan...
NP_813649 601 GKKTGATPDGR------------AKGVAFAPGANPMHg-----RDKNGAIASLSSVAKLRYRDSQDGISNTFSIVPKSLG 663 Bacteroides thetai...
NP_815326 602 GKATGNTPDGR------------RAGKPLAPGANPSYqdgkflGEKNGLLASLNSTARLEYTIALDGISNTQTINPNGLG 669 Enterococcus faeca...
NP_696127 660 GKNTGSFPSGH------------AKGTPYAPGANPENg-----MDSHGMLPSMFSVGKIDYNDALDGISLTNTITPDGLG 722 Bifidobacterium lo...
NP_471365 609 SKQCGNSPVHKgpvfde-ngkiiKEPEFFSPGANPSN------KAKGGFLDNLASLSKLPFHYANDGISLTIQGAPKMFG 681 Listeria innocua C...
YP_017128 608 GKKTGNTPDGR------------RTGEPFAPGANPMHg-----RDTKGALASLLSVAKLPYEDAQDGISNTFSIIPKALG 670 Bacillus anthracis...
AAL94468  602 GKKTGNTPDGR------------RAGAPFGPGANPMHg-----RDTKGAVASLASVAKLPFEDANDGISYTFAITPETLG 664 Fusobacterium nucl...
Feature 1                                                                                     
1H16_A    676 KDDEVRKTNLAGLMDGYFhhea----siegGQHLNVNVMNREMLLDAMENPekypqLTIRVSGYAVRFNSLTKEQQQDVI 751 Escherichia coli
Q46266    662 NDHDVRINNLVSIMGGYFgq---------gAHHLNVNVLNRETLIDAMNNPdkyptLTIRVSGYAVNFNRLSKDHQKEVI 732 Clostridium pasteu...
O32799    690 KTRDEQVDNLVQILDGYFtpgalingtefaGQHVNLNVMDLKDVYDKIMRGe---dVIVRISGYCVNTKYLTPEQKQELT 766 Lactococcus lactis...
CAA76352  727 KSLQERQGNLSGLLDGYFtk---------gAHHLNVNVLKRETLEDAMAHPenypnLTIRVSGYAVNFVKLTPQQQKEVI 797 Piromyces sp. E2
AAF18275  692 MNKEERIDNLIGLLSGYFga---------gAHHMNVNVFDRNTLLDAVDHPekypqLTIRVSGYAVNFVKLTREQQMDVI 762 Zymomonas mobilis
NP_681780 677 KTREDQISNLVNMLDGYIhd---------qGFHINVNVLNREMLLDAMDHPelypqLTIRVSGYAVNFIKLTREQQLDVI 747 Thermosynechococcu...
NP_786563 674 HDLESRKDTLVNMLDGYMkn---------dGMHLNINVFNKDTLIDAQKHPeeyptLTVRVSGYCVYFADLTKEQQDDVI 744 Lactobacillus plan...
NP_813649 664 ATDEDRIENLVTMMDGYFtk---------gAHHLNVNVLNRDMLYDAMEHPenypqLTIRVSGYAVNFVKLSREHQLEVI 734 Bacteroides thetai...
NP_815326 670 KDDDTRINNLRNVLDGYFdk---------gGYHLNVNVFTNELLLDAQAHPekypnLTIRVSGYAVKFRDLTPEQQADVI 740 Enterococcus faeca...
NP_696127 723 RDEDERIGNLVGILDAGNgh---------gLYHANINVLRKETMEDAVEHPekyphLTVRVSGYAVNFVKLTKEQQLDVI 793 Bifidobacterium lo...
NP_471365 682 KTTEEQYHNLVGILDGYFtk---------gGQHINLNVLNHDEVIEKIKAGi---pVILRISGYCLNTKDLNEEQKMELC 749 Listeria innocua C...
YP_017128 671 KEDEVQVRNLVSMLDGYAvk---------eGHHLNINVFNRETLMDAMEHPekypqLTIRVSGYAVNFIKLTREQQIDVI 741 Bacillus anthracis...
AAL94468  665 KTDDEKKNNLVGLLDGYFkq---------tGHHLNVNVFGRELLEDAMEHPenypqLTIRVSGYAVNFIKLTREQQLDVI 735 Fusobacterium nucl...
Feature 1          
1H16_A    752 TRTFT 756 Escherichia coli
Q46266    733 SRTFH 737 Clostridium pasteurianum
O32799    767 ERVFH 771 Lactococcus lactis subsp. cremoris
CAA76352  798 ARTFH 802 Piromyces sp. E2
AAF18275  763 HRTFH 767 Zymomonas mobilis
NP_681780 748 NRTFH 752 Thermosynechococcus elongatus BP-1
NP_786563 745 SRTFF 749 Lactobacillus plantarum WCFS1
NP_813649 735 SRSFH 739 Bacteroides thetaiotaomicron VPI-5482
NP_815326 741 SRTSH 745 Enterococcus faecalis V583
NP_696127 794 SRTFH 798 Bifidobacterium longum NCC2705
NP_471365 750 QRMFH 754 Listeria innocua Clip11262
YP_017128 742 NRTMH 746 Bacillus anthracis str. 'Ames Ancestor'
AAL94468  736 NRTIS 740 Fusobacterium nucleatum subsp. nucleatum ATCC 25586

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap