Conserved Protein Domain Family

cd01658: Ribosomal_L30 
Click on image for an interactive view with Cn3D
Ribosomal protein L30, which is found in eukaryotes and prokaryotes but not in archaea, is one of the smallest ribosomal proteins with a molecular mass of about 7kDa. L30 binds the 23SrRNA as well as the 5S rRNA and is one of five ribosomal proteins that mediate the interactions 5S rRNA makes with the ribosome. The eukaryotic L30 members have N- and/or C-terminal extensions not found in their prokaryotic orthologs. L30 is closely related to the ribosomal L7 protein found in eukaryotes and archaea.
PSSM-Id: 100100
View PSSM: cd01658
Aligned: 102 rows
Threshold Bit Score: 49.7271
Threshold Setting Gi: 183221330
Created: 6-Mar-2002
Updated: 2-Oct-2020
Aligned Rows:
23S rRNA
Conserved site includes 21 residues -Click on image for an interactive view with Cn3D
Feature 1:23S rRNA binding site [nucleic acid binding site]
  • Structure:1SM1_X; Deinococcus radiodurans 50S ribosomal protein L30 binds 23S rRNA
    View structure with Cn3D

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1              ## ## ###  ##  ### #  #    ##  ### ##           
NP_218646      5 VRITLVRSTIGQREPVRRTVRSLGLRKLHSMVEKDGSPAVLGMVRAVSHLVRVE 58  Treponema pallidum subsp. pallidum str. N...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap