1OX4,1G2I,1G2I,1GGE,1GPM,1GPM,1I1Q,1I7Q,1JDB,1K9V,1KA9,1KEE,1KWK,1L9X,1O1Y,1OI4,1ONS,1PDW,1PV2,1Q7R,1QDL,1QVW,1R9G,1S1M,1SOA,1SY7,1T0B,1T3T,1U9C,1VCO,1VHQ,1WL8,2A9V,1J42,1PS4,1PE0,1VCN


Conserved Protein Domain Family
GATase1

?
cd01653: GATase1 
Click on image for an interactive view with Cn3D
Type 1 glutamine amidotransferase (GATase1)-like domain
Type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to Class I glutamine amidotransferases, the intracellular PH1704 from Pyrococcus horikoshii, the C-terminal of the large catalase: Escherichia coli HP-II, Sinorhizobium meliloti Rm1021 ThuA. and, the A4 beta-galactosidase middle domain. The majority of proteins in this group have a reactive Cys found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For Class I glutamine amidotransferases proteins which transfer ammonia from the amide side chain of glutamine to an acceptor substrate, this Cys forms a Cys-His-Glu catalytic triad in the active site. Glutamine amidotransferases activity can be found in a range of biosynthetic enzymes included in this cd: glutamine amidotransferase, formylglycinamide ribonucleotide, GMP synthetase, anthranilate synthase component II, glutamine-dependent carbamoyl phosphate synthase, cytidine triphosphate synthetase, gamma-glutamyl hydrolase, imidazole glycerol phosphate synthase and, cobyric acid synthase. For Pyrococcus horikoshii PH1704, the Cys of the nucleophile elbow together with a different His and, a Glu from an adjacent monomer form a catalytic triad different from the typical GATase1 triad. The E. coli HP-II C-terminal domain, S. meliloti Rm1021 ThuA and the A4 beta-galactosidase middle domain lack the catalytic triad typical GATaseI domains. GATase1-like domains can occur either as single polypeptides, as in Class I glutamine amidotransferases, or as domains in a much larger multifunctional synthase protein, such as CPSase.
Statistics
?
PSSM-Id: 153210
View PSSM: cd01653
Aligned: 1656 rows
Threshold Bit Score: 29.8739
Threshold Setting Gi: 73667162
Created: 12-Dec-2003
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
conserved cys
Conserved site include 1 residue -Click on image for an interactive view with Cn3D
Feature 1:conserved cys residue [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                       
1OX4_A        7 VHVIDvesgnl-----------------------------qsltnAIEHLg-------------YEVQLVKspkdf---- 40  baker's yeast
1T0B_A       10 VVVWNefrhekkdeqvra---------------iypegmhtviasYLAEAg-------------FDAATAVldepehgl- 60  Geobacillus stea...
AAK43109    327 SAILVpswfyrnfqfvpe--------------qdrrwdfarvlnqAFAFArl----------snIQVTFVReddqn---- 378 Sulfolobus solfa...
NP_621764   354 AIIIPdkyyealfvgkdyt-------------pernfrillnsfiLAKQAg-------------LDVDLIRpedd----- 402 Thermoanaerobact...
ZP_00777574 574 TQVMFdlnsfseeiielreqprplrlfysettaintddymtkgykLYEELff----------egLPLGFVTkniiek--- 640 Pseudoalteromona...
NP_104286     5 AVVWGenvheqtnaavrd---------------lypltmhgtiaaALNQDk------------gIEATTATlqepehgl- 56  Mesorhizobium lo...
AAV44979     36 VTVWNenvheqeheavad---------------lypdgihgtiatALAERg-------------FDTETATlqepehgl- 86  Haloarcula maris...
AAV46238     39 VTVWNenqheratgpana---------------mypdgihttlaeTLTSYg-------------HTVQTATlddpahgl- 89  Haloarcula maris...
EAL94527      9 VTVWSenrhekrdelvar---------------lypdgmhgavkaGIEENlg----------akVSVRTATldepqhgl- 62  Arthrobacter sp....
ZP_00595481  14 VKLLWlpdampg--------------------------tlfgaldVLRTAagvaqlqrpgesnlLTWEIIGgngralpap 67  Ralstonia metall...
Feature 1                                                                      #                
1OX4_A       41 -----------nisgtSRLILPGVgnyghfvdn-------lfnrgfekpIREYIesgkPIMGICVGLQALfagsvespks 102 baker's yeast
1T0B_A       61 --------tdevldrcDVLVWWGHiahdevk------------devverVHRRVlegmGLIVLHSGHFSKifkklmgttc 120 Geobacillus stea...
AAK43109    379 ------------lsdyKLLIIPSVtrllttt------------wrkllkIVENGt---SVYFSTYTLTHMsathlweelf 431 Sulfolobus solfa...
NP_621764   403 ------------fkkyKLLIVPSAyrkghlty---------sqwlkvmeFVKEGg---TLYLSYDGIAIEgfeevfgvki 458 Thermoanaerobact...
ZP_00777574 641 ----------qdnsawDTVIVYNNpnvsdae------------faalqsYLEQGg---TVILDTKSLQFNeygqirkqsl 695 Pseudoalteromona...
NP_104286    57 --------sekrlaatDVLLWWGHaahgevk------------deiverVQKRVwegmGLIVLHSGHYSKifkrlmgtpc 116 Mesorhizobium lo...
AAV44979     87 --------tgdvlaetDVLTWWGHaahdeva------------devvarVKERVldgmGLIVLHSGHYSKifrelmgttc 146 Haloarcula maris...
AAV46238     90 --------tetvlaetDVLLWWSDiahdvvs------------datanrVEQAVrdgmGFIPLHSSHESKpfealmggtg 149 Haloarcula maris...
EAL94527     63 --------seevlantDVLTWWGHmshgdve------------deiverVHRHVlsgmGLIVLHSGHWSKiftklmgtsc 122 Arthrobacter sp....
ZP_00595481  68 lpglqpvparrgqrhgRTLMIVPGlmahsaphlsemvtndtvtqrtiarHVDAGg---WLAAIYSGMVYPlalglldgar 144 Ralstonia metall...
Feature 1                                                                                       
1OX4_A      103 tglnyidfklsrfddsekpvpeigwnscipsenlffgldpykryyfvhsfaailnsekkknlendgwkiakakygseefi 182 baker's yeast
1T0B_A      121 nlkwreadekerlwvvapghpivegigpyiel-------------eqeemygeffdipepdetifiswfeggevfrsgct 187 Geobacillus stea...
AAK43109    432 gvmpnnpagsrgvkipervrllennlvld--------------------lgqtnmytysfkekdakvigidensnigvaf 491 Sulfolobus solfa...
NP_621764   459 eyfmvpreenveieseilparlefkalp----------------------snkrlilkpikgetiakdkegnpsiivnqy 516 Thermoanaerobact...
ZP_00777574 696 kaskgklialeaeadiak------------------------------------------ikqvalaeiadsmpdillke 733 Pseudoalteromona...
NP_104286   117 slkwreagerervwainrghpiaqgigeclei-------------getemygepfavpepmetvfvswyeggevfrsglt 183 Mesorhizobium lo...
AAV44979    147 slkwreaaeterlwvvepghpiadgideyiel-------------petemygerfdipapdtlvfnswfeggevfrsgcc 213 Haloarcula maris...
AAV46238    150 tlrwreegerehvwvveashpitdglpeefel-------------eraeiygkgfdlptpdtlvtvswcddgtvfpsgcc 216 Haloarcula maris...
EAL94527    123 tlrwrseqdrelvwtvdpthpitrgvphpivi-------------dqqemygeffdiptpeelvfissfsggevfrsgct 189 Arthrobacter sp....
ZP_00595481 145 cgapwmfqss---------------------------------------------------------laqrfpgcdlssd 167 Ralstonia metall...
Feature 1                                                   
1OX4_A      183 aavnknnIFATQFhpeks----------------gkaglNVIEN 210 baker's yeast
1T0B_A      188 ftrgkgkIFYFRPghetypt------------yhhpdvlKVIAN 219 Geobacillus stearothermophilus
AAK43109    492 lakrgkgNVILSTvplelissn--------yetmkenriSFYNY 527 Sulfolobus solfataricus P2
NP_621764   517 gkgrailVTYPIElylsympd----------vyksnesfKIYQL 550 Thermoanaerobacter tengcongensis MB4
ZP_00777574 734 dngepfkTTTWRTikqpd----------------gsylvNILNV 761 Pseudoalteromonas atlantica T6c
NP_104286   184 yqrgagrIFYFSPghetypi------------yhnegvqQVLRN 215 Mesorhizobium loti MAFF303099
AAV44979    214 yrrgagrIFYFRPghetypi------------yhndavqQVLAN 245 Haloarcula marismortui ATCC 43049
AAV46238    217 yyrdagrIFYFQPghetfpv------------yhrpvvqKLLHN 248 Haloarcula marismortui ATCC 43049
EAL94527    190 frrghgkIFFFSPgdqdypv------------yhhkdvrRVIAN 221 Arthrobacter sp. FB24
ZP_00595481 168 epiglheRVFHCVapalltefmlrvlghlhdpdlaqtvsRLLLY 211 Ralstonia metallidurans CH34

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap