Conserved Protein Domain Family
AcnA_Bact

?
cd01585: AcnA_Bact 
Aconitase catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle
Bacterial Aconitase-like catalytic domain. Aconitase (aconitate hydratase or citrate hydrolyase) catalyzes the reversible isomerization of citrate and isocitrate as part of the TCA cycle. Cis-aconitate is formed as an intermediate product during the course of the reaction. This distinct subfamily is found only in bacteria and Archaea. Its exact characteristics are not known.
Statistics
?
PSSM-Id: 153135
View PSSM: cd01585
Aligned: 9 rows
Threshold Bit Score: 694.964
Threshold Setting Gi: 45548224
Created: 16-Jul-2004
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
ligand bindingsubstrate
Feature 1:ligand binding site [chemical binding site]
Evidence:
  • Comment:Binds the Fe-S cluster required for activity.
  • Comment:Based on related sequences with known structures.
  • Citation:PMID 3972791

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                       
ZP_00188258  30 DQTLLQDATGTMACLQFERMGVDRVRVPFAVQYVDHNIIQLDHKNPDDHRFLQAFAARYGIHYSRPGNGICHYLHVERFA 109 Rubrobacter xyla...
NP_281140    30 DQTLSQDTTGTMVWLQFEALEMDEVQTELAAQYCDHQTYQFDFKNTDDHRFLRSAAGTYGAYFSRPGNGICHNVHKENFA 109 Halobacterium sp...
NP_214222    31 DQTLTQDATGTMCYLEFEAMGVPEVKTELSVSYIDHNMLQTDFRNADDHKYLMSVAKKFGIWLSKPGNGICHQVHLERFA 110 Aquifex aeolicus...
NP_927033    28 DQTLTQDATGTMAYLQFEAMGLPRVRTKLSVSYIDHNMLQTGFENADDHRYLQSVGQKYGIVFSRPGNGICHQVHRERFA 107 Gloeobacter viol...
AAM23754     28 DQTLTQDSTGTMAYLQLEALGIDRVKTELSVSYVDHNTLQQGPENADDHKYLQTVAARYGIYFSRPGNGICHQVHLERFG 107 Thermoanaerobact...
ZP_00312264  30 DQTLTQDSTGTMAYLQFEAMGIPRVKTKKSVAYIDHNTLQTGFENADDHKYIQTVAAKHGIYFSKPGNGICHQVHLERFG 109 Clostridium ther...
ZP_00330743  30 DQTLTQDATGTMAYLQLEAMGVPRVRTRLSVSYVDHNTLQTGFENADDHLFLQGIAAKYGIIFSRPGNGICHQVHLERFA 109 Moorella thermoa...
YP_010285    30 DQTLTQDATGTMAYLQFEAMGVDRVRTDLSVSYVDHNTLQMGFRNADDHRFLRTVAARHGIVFSAPGNGICHQLHLENFG 109 Desulfovibrio vu...
ZP_00298831  36 DHALLQDATGTMAMLEFIAMGVDRVKVELAAQYIDHNLLQTDNRNADDHIFLMTAAQRFGIHVSKPGNGVSHQVHLERFG 115 Geobacter metall...
Feature 1                  #                                                                    
ZP_00188258 110 RPGATLIGADSHTTSSGALGSIAIGAGGLDVALVMAGQPFQTPAPKVVGVELTGElsdWVTPKDVILELLRRRGVRGGLN 189 Rubrobacter xyla...
NP_281140   110 APGKTLLGSDSHTPTPGGLGQLAIGAGGIDIAVAMGGGAYYVEMPEVVNVRLEGElpeWATAKDVILELLRRLSVKGGVG 189 Halobacterium sp...
NP_214222   111 KPGKTLLGSDSHTPTAGGMGMLAIGAGGLDVAAAMAGEPFYLKMPKIVGVHLKGKmpeWVTAKDIILELLRRLTVKGGLG 190 Aquifex aeolicus...
NP_927033   108 VPAQTLLGSDSHTPTCGGLGMLAIGAGGLDVAVAMAGEPYFIPMPKVLGVRLTGTlqpWCSGKDVILEMLRRLTVKGGTG 187 Gloeobacter viol...
AAM23754    108 VPGKTLLGSDSHTPTAGGLGMLAIGAGGLDVALAMAGEPYRIIMPAIVNVRLKGElnpWVSAKDVILELLRRLTVKGGIG 187 Thermoanaerobact...
ZP_00312264 110 VPGMTLLGSDSHTPTGGGIGMLAIGAGGLDVAVAMGGGPYYMMMPKVCRVVLKGAlkpWVTAKDIILEVLRRLSVKGGVG 189 Clostridium ther...
ZP_00330743 110 VPGTTLLGSDSHTPTAGGLGALGIGAGGLDVAVAMAGGPFYFNMPAVVRVNLHGRlapWVSAKDIILEVLRRLSVKGGVG 189 Moorella thermoa...
YP_010285   110 RPGATLVGSDSHTPTAGGIGALAMGAGGLSVALSMAGEPYTITMPKVVNVRLEGRltgWAAAKDVILHLLGLLTVKGGVG 189 Desulfovibrio vu...
ZP_00298831 116 VPGKTMLGADSHTTSAAGLSMIAIGAGGLDVSLAMAGHPFHLPCPKIWGVKLTGElqpWVSAKDVILEMLRRHTVKGGVG 195 Geobacter metall...
Feature 1                                                                                       
ZP_00188258 190 RIFEFYGEGVATIDVTGRTTICNMIAELGATTGIFPSDERTREWLEAQQRPDDFVELAADEGASYDEHEHIALDELEPLI 269 Rubrobacter xyla...
NP_281140   190 KVLEYTGPGVESLSVPERTTITNMGTELGATSSIFPTDDRTEDWLARFDREDEFVDLQADADAEYADEIVVDLSDLEPLI 269 Halobacterium sp...
NP_214222   191 KIFEYFGEGVKELSVPERATITNMGAELGATTSIFPSDEITRAYLRAQGREEDWVELLPDPDAEYDEVIEINLSELEPLI 270 Aquifex aeolicus...
NP_927033   188 RIVEYTGPGVASLSVSHRFTITNMGAELGATTSVFPSDEVTHRFLAAQGREGDWVPLAADPDATYDETVEIDLDTLEPLT 267 Gloeobacter viol...
AAM23754    188 KIFEYSGDGVKTLSVPERTTIANMGAELGATTSIFPSDERTYEFLKAQGREDVFVPLSADEDAEYDEVIEIDLSELEPMV 267 Thermoanaerobact...
ZP_00312264 190 KIIEYAGDGIKTLTVPERATITNMGAELGATTSIFPSDEVTREFLRAQGRENDWVELKPDEDAEYDEEIVINLDELEPLA 269 Clostridium ther...
ZP_00330743 190 KVIEYGGDGVATLSVPERATITNMGAELGATTSIFPSDAVTRAFLTAQGRAGDWVELLPDADATYDQVIDIDLAALEPLV 269 Moorella thermoa...
YP_010285   190 RVFEYTGPGVATLSVPERATITNMGAELGATTSIFPSDESTRAFLAAMGREADWQPLAADAGAVYDEEVVIDLSQLEPLV 269 Desulfovibrio vu...
ZP_00298831 196 KIIEYYGPGVATLSATDRAIIGNMGAELGATTSVFPSDHRTREFLEAQGRGQLWQELAADPDATYDEYEEIDLATVEPLI 275 Geobacter metall...
Feature 1                                  #                                                    
ZP_00188258 270 AKPHSPGNVVKVEEVAGTKAAQVCIGSSVNSGFDDLAVAAAVLRDQIVYPGLVMTVTPGSRQILDSIARTGVYSDLVLAG 349 Rubrobacter xyla...
NP_281140   270 AEPSMPDNVVPVREVAGQEVEQVMVGSCTNGAYEDVLPAAKMLEGREVSKHTEMIVAPGSKQASEMLAREGWTAEMMAAG 349 Halobacterium sp...
NP_214222   271 AQPHSPDNVVPVREIEGIKVDQVVIGSCTNSSFVDLTRAAKLLEGRRVHPDVVFAVAPGSKQALELITQNGALLNFLKAG 350 Aquifex aeolicus...
NP_927033   268 ACPSSPDNVVSVRAVAGTPVVQVCIGSCTNSSYEDLATAALLLRGRRVHPNVSMTVTPGSKQVFEMIVRDGYFADLIAAG 347 Gloeobacter viol...
AAM23754    268 ALPHSPDNVVKVKDAGRPRVDQVAIGSCTNSSYMDLMKVASILKGKTIPEHVSLVIAPGSRQVLTMLAKNGALADLIAAG 347 Thermoanaerobact...
ZP_00312264 270 AQPHSPDNVAKVKDIGKIKVDQVAIGSCTNSSYMDMMKVAAILKGKKVHPDVSLVIAPGSKQVLTMLAQNGALADMVAAG 349 Clostridium ther...
ZP_00330743 270 ARPHMPDNVAPVREVGPIKVNQVAIGSCTNSSYTDLMRVAAILKGKRVHPDVSLVIAPGSRQVFRMLAKNGALADLITAG 349 Moorella thermoa...
YP_010285   270 ATPHMPDRVVTVASLAGLKVDQVAIGSCTNSSYADLKSVAQVVAGRRVDSTTDCMISPGSKQVLRMLATEGLLEPLLDAG 349 Desulfovibrio vu...
ZP_00298831 276 ARPSSPDNVVRVADIEGLKVDQVLVGSSANSAFRDLMTVCRILDGRRIAPHLSFNVNPGSRQVLENVADQGGIMMLLLAG 355 Geobacter metall...
Feature 1              #  ##                #                               
ZP_00188258 350 ARMLEPVCGPCVGMGQAPPSDSVSVRTFNRNFPGRSGTMNDHVYLTTPTVAAATALKGVI 409 Rubrobacter xylanophilus DSM 9941
NP_281140   350 VNFSEATCGACIGIGHVPASDSVSLRTFNRNFEGRSGIEDDSVYLCSPEVATASAIAGEI 409 Halobacterium sp. NRC-1
NP_214222   351 ARILESACGPCIGMGFAPPTNGVSVRSFNRNFKGRAGTPDAKVYLASPETCVAAAIAGEI 410 Aquifex aeolicus VF5
NP_927033   348 CRILESACGPCIGMGQAPPTGGVSVRSFNRNFKGRSGTADDLVYLASPEVCVACALTGEI 407 Gloeobacter violaceus PCC 7421
AAM23754    348 ARILESACGPCIGMGQAPATGAVSVRTFNRNFYGRSGTKSAYVYLVSPEVAAAAALTGYL 407 Thermoanaerobacter tengcongensis MB4
ZP_00312264 350 ARILESACGPCIGMGQAPATDAVSLRTFNRNFEGRSGTKSAKVYLVSPETAAASAITGVL 409 Clostridium thermocellum ATCC 27405
ZP_00330743 350 ARILECACGPCIGMGQAPPSGGVSVRTFNRNFQGRSGTADALIYLASPEVAAATALKGYL 409 Moorella thermoacetica ATCC 39073
YP_010285   350 IRMLECTCGPCIGMGGSPVSGGVSVRTFNRNFEGRSGTKDAGVYLASPLTAAMVALHGGF 409 Desulfovibrio vulgaris subsp. vulgar...
ZP_00298831 356 AQIHQPGCLGCIGMGQAPGTNQVSLRTFPRNFPGRSGTKNDLVYLCSPETAAAAGLFGVV 415 Geobacter metallireducens GS-15

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap