Conserved Protein Domain Family
Homoaconitase

?
cd01582: Homoaconitase 
Homoaconitase and other uncharacterized proteins of the Aconitase family
Homoaconitase catalytic domain. Homoaconitase and other uncharacterized proteins of the Aconitase family. Homoaconitase is part of an unusual lysine biosynthesis pathway found only in filamentous fungi, in which lysine is synthesized via the alpha-aminoadipate pathway. In this pathway, homoaconitase catalyzes the conversion of cis-homoaconitic acid into homoisocitric acid. The reaction mechanism is believed to be similar to that of other aconitases.
Statistics
?
PSSM-Id: 153132
View PSSM: cd01582
Aligned: 4 rows
Threshold Bit Score: 646.209
Threshold Setting Gi: 46101014
Created: 16-Jul-2004
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
ligand bindingsubstrate
Feature 1:ligand binding site [chemical binding site]
Evidence:
  • Comment:Based on related sequences with known structures.
  • Citation:PMID 3972791

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                     
NP_593437  93 HCMSHDNSWPVALKFMGIGAKKVFDNRQIVCTLDHDVQNKSEANLRKYKNIESFAKGQGIDFYPAGRGIGHQIMVEQGYA 172 fission yeast
Q92412     98 RCMTHDNSWPCALKFMSIGASRLHNPDQIVMTLDHDVQNKSDKNLKKYRQIEEFATQHGVEFYPAGRGIGHQIMIEEGFA 177 Emericella nidulans
EAK86247   70 TVMTHDNTGPVISKFGSIGATSIYNPDQVVFALDHDVQNKSAKNLEKYSKIESFARKHGIDFYPAGRGIGHQVLVEEGYA 149 Ustilago maydis 521
P49367     53 HCMSHDNSWPVALKFMGLGATKIKNPSQIVTTLDHDIQNKSEKNLTKYKNIENFAKKHHIDHYPAGRGIGHQIMIEEGYA 132 baker's yeast
Feature 1                #                                                                    
NP_593437 173 MPGSMAVASDSHSNTYGGVGCLGTPIVRTDAAAIWATGQTWWQIPPIARVNLVGQLPKGLSGKDIIVSLCGAFNHDEVLN 252 fission yeast
Q92412    178 WPGTLAVASDSHSNMYGGVGCLGTPIVRTDAASVWATGKTWWQIPPVAKVTFKGVLPPGVTGKDVIVALCGLFNKDDVLN 257 Emericella nidulans
EAK86247  150 FPQTLAVASDSHSNMYGGVGCLGTPIVRTDAAAIWATGQTWWQIPEVVKVELKGELPKGVTGKDVIVALCGYFNKDQVLN 229 Ustilago maydis 521
P49367    133 FPLNMTVASDSHSNTYGGLGSLGTPIVRTDAAAIWATGQTWWQIPPVAQVELKGQLPQGVSGKDIIVALCGLFNNDQVLN 212 baker's yeast
Feature 1                                                                                     
NP_593437 253 HAIEFYGegl--nsLSIESRLTIANMTTEWGALSGLFPTDekllawyedrlkflgpnhprv-------------nretld 317 fission yeast
Q92412    258 HAIEFTGseetmrsLSVDTRLTIANMTTEWGALSGLFPIDsvlkgwlrgkattaamgladgpfktr---aaerfthplle 334 Emericella nidulans
EAK86247  230 AAIEFHGsgl--ssLSVEERLAIANMTTEWGALAGLFPTDdvtlswyekqirkrdklefqigsspspsnshprlnmnrld 307 Ustilago maydis 521
P49367    213 HAIEFTGdsl--naLPIDHRLTIANMTTEWGALSGLFPVDktlidwyknrlqklgtnnhprin----------pktiral 280 baker's yeast
Feature 1                                                                #                    
NP_593437 318 aikaspiladegafyAKHLILDLSTLSPAVSGPNSVKVYNSAatlekkdilikkAYLVSCTNgrlsDIHDAAETVkgkk- 396 fission yeast
Q92412    335 qlfenpltadkgakyAKELFLDLSSLSPYVSGPNSVKVATPLkeleaqnikvdkAYLVSCTNsrasDIAAAAKVFkeaae 414 Emericella nidulans
EAK86247  308 elsrtllrpdsgavySKHLTLDLATLVPHVSGPNSVKVSTPLdeltsqniainkAYLVSCVNsrasDLKAAADVIrgkk- 386 Ustilago maydis 521
P49367    281 eekakipkadkdahyAKKLIIDLATLTHYVSGPNSVKVSNTVqdlsqqdikinkAYLVSCTNsrlsDLQSAADVVcptgd 360 baker's yeast
Feature 1                                                    #  ##                 #          
NP_593437 397 -------vadgVEFYVGAASsEVEAAAQkNGDWQTLIDSGARTLpAGCGPCIGlgtgllkdgEVGISATNRNFKGRMGsr 469 fission yeast
Q92412    415 knggkipkihgVKFYIAAASiPEQLAAEgNGDWQTLLEAGATQLpAGCGPCIGmgqgllepgEVGISASNRNFKGRMGst 494 Emericella nidulans
EAK86247  387 -------vapgVEFYVAAASsVVQREAEeAGDWGALMAAGAKPLpAGCGPCIGlgvglledgEVGISATNRNYKGRMGsp 459 Ustilago maydis 521
P49367    361 lnk-vnkvapgVEFYVAAASsEIEADARkSGAWEKLLKAGCIPLpSGCGPCIGlgagllepgEVGISATNRNFKGRMGsk 439 baker's yeast
Feature 1                          
NP_593437 470 ealayLASPAVVAASAIAGKI 490 fission yeast
Q92412    495 eakayLGSPEVVAASALSGKL 515 Emericella nidulans
EAK86247  460 naqayLASPAVVAASAIEGKI 480 Ustilago maydis 521
P49367    440 dalayLASPAVVAASAVLGKI 460 baker's yeast

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap