1JSW,1J3U


Conserved Protein Domain Family
Aspartase

?
cd01357: Aspartase 
Click on image for an interactive view with Cn3D
Aspartase
This subgroup contains Escherichia coli aspartase (L-aspartate ammonia-lyase), Bacillus aspartase and related proteins. It is a member of the Lyase class I family, which includes both aspartase (L-aspartate ammonia-lyase) and fumarase class II enzymes. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. Aspartase catalyzes the reversible deamination of aspartic acid.
Statistics
?
PSSM-Id: 176462
View PSSM: cd01357
Aligned: 45 rows
Threshold Bit Score: 679.245
Threshold Setting Gi: 66856918
Created: 14-Jul-2010
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
active sitestetramer
Conserved site includes 12 residues -Click on image for an interactive view with Cn3D
Feature 1:active sites [active site]
Evidence:
  • Citation:PMID 8909293
  • Comment:The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits.
  • Comment:by similarity to Fumarase active site
  • Structure:1JSW_A, Escherichia coli, L-aspartate ammonia lyase homotetramer, active sites
    View structure with Cn3D
  • Citation:PMID 8263924
  • Citation:PMID 9230045

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                       
1JSW_A        6 RIEEDLLGTREVPADAYYGVHTLRAIENFYISnnkisdipeFVRGMVMVKKAAAMANKELQTIpkSVANAIIAACDEVLn 85  Escherichia coli
ZP_00778443   4 RIEHDLLGQKEVPVDAYYGIHTLRAYENFNISgqki--hreLIISLAMVKKAAAIANMKAGLLdeKRAKAIILACDEIIs 81  Thermoanaerobact...
ZP_00576818   4 RQEHDLLGTREVPATAYYGIHTLRAAENFNVSrarv--hpeLIKALATVKEAAARANLDLGYLpaEKGRAIITACQEVAr 81  Moorella thermoa...
NP_622466     3 RIEKDFLGELTLEDNELYGIHTKRALKNFSVSsqki--didLVRAIVMVKKACAIANFEVGNLdeKIKDAIVFACDEILa 80  Thermoanaerobact...
AAS96243     10 RIEHDLLGDCAVPRTALHGAHTQRALSNVALSgrpl--hpeIIRAFGAVKRACARTNMNLGHLsrEVAEAIIMACDELEd 87  Desulfovibrio vu...
NP_348278     9 RIEKDLLGEKNLPKESYYGINSLRAFENFNISnkkv--nlnLIYAVVIVKKAAALAHKKLKELkdEKADAIISACDDILs 86  Clostridium acet...
YP_357044     5 RTEKDLLGQLEVPEQALYGIHTVRALENFPLTgrkv--sraLVHAFGAVKLACTRTNRELGCWpePKAQALEDACTEMMe 82  Pelobacter carbi...
YP_390040     2 RTEHDALGSRELPADALYGIHTLRAAENFPVSpyrl--appLIRALAQVKLACARTNARLGYLdnRLAEAIETACLEIIg 79  Desulfovibrio de...
ZP_00766645  18 RIERDSLGEMQVPANALYGAQTQRAVLNFPVSgmrp--ypaFVWAQTMIKRAAAEVNRDLGLLdpQIANAIIQAAEEVLa 95  Chloroflexus aur...
ZP_00400978  16 RIERDTMGEMTVPATALYGAQTARAVENFPVSglra--hpaFVDATVRIKLAAARTNAGLGLLprRKARAIEQAAREVLa 93  Anaeromyxobacter...
Feature 1                      ####                                       ###                   
1JSW_A       86 ngkcmDQFPVDVYQGGAGTSVNMNTNEVLANIGLELMghqkg-eyqyLNPNDHVNKCQSTNDAYPTGFRIAVYSSLIkLV 164 Escherichia coli
ZP_00778443  82 gk-yhDQFIVDALQGGAGTSSNMNANEVIANRAIELLggskg-dysiVHPLEHVNLSQSTNDVFPTAVRIAAIRLLKpLS 159 Thermoanaerobact...
ZP_00576818  82 ge-laDQFFLDAYQGGAGTSTNMNVNEVIANRALEILgrpkg-dyatIHPIDHVNLHQSTNDVYPTAMRVAAIRLLLpLA 159 Moorella thermoa...
NP_622466    81 gk-ytEQFVVDKFQGGAGTSTNMNVNEVIANIALIYLgkkpg-eyqyIHPIDHVNMSQSTNDVYPTALRIATIWNVReLS 158 Thermoanaerobact...
AAS96243     88 gg-lgEHIVVDALQGGAGTSANMNVNEVLANRAEEMLggtrg-qyqlVDPLAHVNLHQSTNDVFPTAVRIAALRLLArLE 165 Desulfovibrio vu...
NP_348278    87 gk-fdDEFITNSLQGGAGTSTNMNVNEVIANRAIELLngskg-dysiIHPIEDVNMSQSTNDVYPTALRIAAIKLLRpLS 164 Clostridium acet...
YP_357044    83 gr-ldDHIVVDALQGGAGTSTNMNVNEVLANRALQLLdkplg-eygtVNPLEDVNRHQSTNDTFPTALKVAAIQQLRlLE 160 Pelobacter carbi...
YP_390040    80 gs-hqDSFITDPFQGGAGTSANMNMNEVVANRACQLLggvpg-qhslVSPLNHVNMHQSTNDVFPTALRVAMLHELTaLE 157 Desulfovibrio de...
ZP_00766645  96 gq-haDQFVVDPFQAGAGTSHNMNVNEVLANRANQILgyslddpkkpVSPNDHVNMAQSTNDTIPTAIRLGCLWRLPeLI 174 Chloroflexus aur...
ZP_00400978  94 gr-hrDQFVVDVYQAGAGTSHNMNVNEVLANRACELLggrrg-dralVDPNDDVNMAQSTNDVVPTAIRLAALELAPeVI 171 Anaeromyxobacter...
Feature 1                                ##                                                     
1JSW_A      165 DAINQLREGFERKAVEFQDILKMGRTQLQDAVPMTLGQEFRAFSILLKEEVKNIQRTAelLLEVNLGATAIGTGLNTPKE 244 Escherichia coli
ZP_00778443 160 EDLAELQSVLQEKEEEFSDVCKMGRTELQDALPVMLGQEFGAYAQAVARDRWRIYKVEerLRQVNIGGTAVGTGVNAELK 239 Thermoanaerobact...
ZP_00576818 160 DELAKLQEALQEKEAAFAGVVKIGRTELQDAVPVTLGQEFGAYAQAISRDRWRLYKVEerLRQVNLGGTATGTGLNAPLK 239 Moorella thermoa...
NP_622466   159 EECAELQKSLQKKEHEFEGVIKAGRTQLQDALPITLGQEFGAYAQAISRDRWRIYKIEerLRVVNLGATAVGTGVNASLK 238 Thermoanaerobact...
AAS96243    166 PAIAALQSAFQTHEASFAQVVRLGRTQLQDAVPMTFGAACGAWAEALSRDRWRVFKCSerLRVVNLGGTAIGTGIAAPRS 245 Desulfovibrio vu...
NP_348278   165 DALSKLQESFQIKENDFSDILMLGRTELMDALPMMVGQGFGAYAKAFARDRWRIYKVEerLREINIGGNAIGTGINASYD 244 Clostridium acet...
YP_357044   161 REVVALLEAFQAQEKALAHVVKIGRTQLQDAALTTLGREMSAYADAFARDRWRIYKCEerLRVVNLGGTAIGTGLAAPRQ 240 Pelobacter carbi...
YP_390040   158 KETAALQAQLQQLEAAHQDTLRLGRTQLQDAVPMTFGMTFGAWAEAVARDRWRVFKSRerIRQVSLGGTAIGTGLGAPRD 237 Desulfovibrio de...
ZP_00766645 175 AAIDDLADALEQKAIEFDDVVKSGRTHLQDAVPVRLGQEFGAYAKAVRNDMERIVTAAnrLRRLGIGGTATGTGLNAHPE 254 Chloroflexus aur...
ZP_00400978 172 AALSALAGTFDAKARAWDGVVKSGRTHLMDATPIRLGQEVSGWAAALGAAAGRVRDALpeLSVLGLGGTAVGTGLNADAR 251 Anaeromyxobacter...
Feature 1                                                                                       
1JSW_A      245 YSPLAVKKLAEVTGFPCVPAEDLIEATSDCGAYVMVHGALKRLAVKMSKICNDLRLLSSGPRAGLNEINLPELQAGSSIM 324 Escherichia coli
ZP_00778443 240 YIFSVIEILREITGLGLARAEYMMDPTQNNDVFVEVSGLLKAAAVNLIKISNDIRLMSSGPKCGLMEINIPEVQSGSSIM 319 Thermoanaerobact...
ZP_00576818 240 YIYLVNDYLRRLTGIGLARAENMIDATQNMDVFVEVSGLVKAAAVTMHKIASDLRFMAAGPRGGPAEINLPERQAGSSIM 319 Moorella thermoa...
NP_622466   239 YMFKVIELLRDFTKIGLARSDYLMDATQNADVFVECSGLLKALAVNLSKIANDLRLLSSGPNTGLNEINLPAAQAGSSIM 318 Thermoanaerobact...
AAS96243    246 YILSVVDRLREDTGLPLARAENLMDATQNVDAFVEVSGILKAHASNLLKLSSDLRLLASGPGGGIGEVVLPPVQAGSSIM 325 Desulfovibrio vu...
NP_348278   245 YIFTVTDILQDLTGLGLARSDYPMDVTQNMDVFVEVSGLLKSCAVNLIKISNDIRLLNSGPVGGIGEFIVEEVQAGSSIM 324 Clostridium acet...
YP_357044   241 YIFKVVEKLRSITGLGLARAENLIDATQNVDAFVEVSGILKALATNLLKISGDLRFLSSGPDAGIGELSLPHRQAGSSIM 320 Pelobacter carbi...
YP_390040   238 YILKAADTLRSVTGLKLSRAENLVDATQNTDQLVEVSAILKALAANLLKISTDLRLLGSGPCAGLGELKLPAMQAGSTIM 317 Desulfovibrio de...
ZP_00766645 255 YHSRMVAKLSELTGHELVSSGNLFESMQSMADPADFSASLRTLCITLGRIANDFRLLSSGPATGLDEIRLPAVQPGSSIM 334 Chloroflexus aur...
ZP_00400978 252 YRPRVVQELERLTGVPLTPAPNPFYAMQSLAPFVALSGALRTAALELLRIGGDVRLLGSGPNTGLGELRLPPVQPGSSIM 331 Anaeromyxobacter...
Feature 1         # #    #                                                                      
1JSW_A      325 PAKVNPVVPEVVNQVCFKVIGNDTTVTMAAEAGQLQLNVMEPVIGQAMFESVHILTNACYNLLeKCINGITANKEVCEGY 404 Escherichia coli
ZP_00778443 320 PGKVNPVIPEAVKQAAFQVIACDHAITLCAQAGEFELNFTLPQIAYNLFMQIGLLRNAIRIFIdKCIKGITANKDYLKET 399 Thermoanaerobact...
ZP_00576818 320 PGKVNPVIPEMVSQVAMQVMANDYLIAMAASQGQLELNPFAPLIAHTLLESLAMLAAAARIFRtECITGITANPERCQEL 399 Moorella thermoa...
NP_622466   319 PGKVNPVIPELINTISFQVMSNDVAITLAAQAGQLELNAFLPLIANNLLESLKILKNGIRIFRkQCIDGITANKERCLEF 398 Thermoanaerobact...
AAS96243    326 PGKVNPVVCETVAQAAMQATANDLAITLSAQHGQLELNAFMPLIADALLHGIELLTNACDLFRtRCVEGLHPDTETCARH 405 Desulfovibrio vu...
NP_348278   325 PGKVNPVICEMTAQTSMKVMANDTAISLASSFGQLQLNAFSPLIAESLLESLEILTNAVNVFReKCIDSIKINEEKCLEN 404 Clostridium acet...
YP_357044   321 PGKVNPVIPEAVSQAAMVVMSNDQTIAQACAMGHLELNPFLPLVADALLGSIDLLNHACSILRrFCVEQLEANEARCRQH 400 Pelobacter carbi...
YP_390040   318 PGKVNPVIAEAVSQAALRVLANDGLAAHASAMGTLELNQFMPLLAHTLLESLHLMRSSVTLLNnRCMQGLEPQAEQAQSH 397 Desulfovibrio de...
ZP_00766645 335 PGKVNPVLAEMLNMACYHVQGCDLTVALAAQAGQLELNVMMPIIAHNLFEMMHVLIGAINAFTtKCVVGITANREKAAGW 414 Chloroflexus aur...
ZP_00400978 332 PGKVNPSMAEMLAMVSYQVVALDGAVAWAASGGQLELNVMMPLVAFDLCHALDILARAVRAFDaRCARGLEADRERARHY 411 Anaeromyxobacter...
Feature 1                                                             
1JSW_A      405 VYNSIGIVTYLNPFIGHHNGDIVGKICAETGKSVREVVLERgLLTEAELDDIFS 458 Escherichia coli
ZP_00778443 400 IEKSYSYATALVPYIGYEKATEIAKMAKEKGKTIREVVLEAgLFTEEELDIIFN 453 Thermoanaerobacter ethanolicus ATCC 33223
ZP_00576818 400 LAVSPALATALLPYIGYEKATEVVREAVVSGRSIKEIVLEEgYLTSDELENVLT 453 Moorella thermoacetica ATCC 39073
NP_622466   399 AKKTPSIAAALIDKIGYDKASEIAKKAIAENKEIIEVVKELkILNENEAEALLN 452 Thermoanaerobacter tengcongensis
AAS96243    406 VSTSTATLTALVPEIGYAAASEMARHMREHGTDVFGAAKATgLIDEDRLARLLS 459 Desulfovibrio vulgaris subsp. vulgaris str...
NP_348278   405 LEASTALVTALVHYIGYDKASIIAKKALKEKKSIRELLLLEkILTKEEIDKILN 458 Clostridium acetobutylicum ATCC 824
YP_357044   401 VINSTASVTALVSLIGYQKATELAQQVATTGRGLRELAIEGgLVTAETFDELIS 454 Pelobacter carbinolicus DSM 2380
YP_390040   398 VGRSAALAAVLVPLAGHTAVEQMLHTARTTGTPFARVAAQAlCVPEDNIRSLLA 451 Desulfovibrio desulfuricans G20
ZP_00766645 415 LAKNAILVTALNPVIGYLNGAAVAKEAMATGKTIKEVVVEKgLLTAEQVDELLD 468 Chloroflexus aurantiacus J-10-fl
ZP_00400978 412 AERTVSLATALAPRLGYAAAAEIVKASVATGRSIVDLAVERgGLTPAQARRALD 465 Anaeromyxobacter dehalogenans 2CP-C

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap