Conserved Protein Domain Family
IBD

?
cd01162: IBD 
Isobutyryl-CoA dehydrogenase
Isobutyryl-CoA dehydrogenase (IBD) catalyzes the alpha, beta- dehydrogenation of short branched chain acyl-CoA intermediates in valine catabolism. It is predicted to be a homotetramer.
Statistics
?
PSSM-Id: 173851
View PSSM: cd01162
Aligned: 9 rows
Threshold Bit Score: 654.898
Threshold Setting Gi: 31791939
Created: 26-Mar-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:FAD binding site [chemical binding site]
Evidence:
  • Comment:based on similarity to related acyl-CoA dehydrogenases

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                     
AAH44203   43 LTDEQKEFQKVAFDFAANEMAPHMAEWDQKeiFPVEAMRKAAELGFgGIYVNPDVGGSGLsRLDTSIIFEALSTGCVSTT 122 zebrafish
Q9UKU7     41 LNEEQKEFQKVAFDFAAREMAPNMAEWDQKelFPVDVMRKAAQLGFgGVYIQTDVGGSGLsRLDTSVIFEALATGCTSTT 120 human
NP_493832  27 LERDVEDVLEAAHQFAKKEMYPKMADWDKQgeLPMDVLRKAGEMGFgAIYCSGDHGGSGLsRLHASVIFEQLSMGCVSTA 106 Caenorhabditis ele...
NP_102846  14 LNEEQRAIQEMAQAFAADRVAPNALDWDRRkhFPADVIRETGPLGLgGIYVRDDVGGSALgRLDAVLIFEALSHADPGFS 93  Mesorhizobium loti
AAH56845   40 LSEEQTEFQKVALDFAAKEMAPHMALWDEKeiFPVETMRKAAQLGFgGIYTQTDVGGSGLsRLDTSIIFEALSTGCVSTT 119 African clawed frog
NP_437985   5 LSEEQEAIRTMALDFARDEIAPHAVDWDQQkhFPVETLRAAAALGMaGIYIRDDVGGTGLtRLDAAMIIEALATGCPAIA 84  Sinorhizobium meli...
NP_420163   5 LNEDQVAIQDAARAFAEGQLAPHSADWDENkhFPVDVLRQAAELGFaGIYVNEDVGGSGLsRLDASIIFEALSYGDVPVA 84  Caulobacter cresce...
NP_854432   4 LNDDERVIVETAAAFAGKRLAPHALEWDAAkhFPVDVLREAAELGMaAIYCRDDVGGSGLrRLDGARIFEQLAIADPVTA 83  Mycobacterium bovi...
NP_249437   5 LTEEQRLLVESARAFARHELAPKAADWDRDhhFPVEVIRAAAEQGYlGLYIAEEDGGLGLsRLSTSLIFEQLAAGCVATT 84  Pseudomonas aerugi...
Feature 1                                          # ##    ##                           # #   
AAH44203  123 AYVSIHNMCAWMIDTFGNNEQRERFCPDLCSmqKFASYCLTEPGSGSDAASLLTSATLK----GDHYILNGSKAFISGGG 198 zebrafish
Q9UKU7    121 AYISIHNMCAWMIDSFGNEEQRHKFCPPLCTmeKFASYCLTEPGSGSDAASLLTSAKKQ----GDHYILNGSKAFISGAG 196 human
NP_493832 107 AYISIHNMCAWMLDTYGPEKLKEDLLPDMAVfkKLGSYCLTEPDAGSDAASIRTTATKK----GDYYVVNGSKAFISGAG 182 Caenorhabditis ele...
NP_102846  94 SFISIHNMVASMIDRFGNDEQRQRFLPKLTSmeWLASYCLTEPGSGSDAAALKTRAVKS----GGDYVLNGAKQFISGAG 169 Mesorhizobium loti
AAH56845  120 AYMSIHNMCVWMIDTFGNEEQRHRFCPSLCSmdKFASYCLTEPGSGSDAASLLTSAKRD----GDCYVLNGSKAFISGGG 195 African clawed frog
NP_437985  85 SFVSIHNMCAGMIDRYGTDEQRRRLLPPLLTmdVLASYCLTEPGSGSDAAALKTRAVRE----GDAYLLTGQKQFISGAG 160 Sinorhizobium meli...
NP_420163  85 AYLTIHNMASWMIDRFGSDDLRQRYLPRLTTmeLIASYCLTEPGSGSDAAAMRTTAKLD----GDHYVLNGGKAFISGGG 160 Caulobacter cresce...
NP_854432  84 AFLSIHNMCAWMIDSFGTDEQRKDWIPRLATmgVIASYCLTEPGAGSDAGALSTRAVRHgsgkGGDYVLDGVKQFISGAA 163 Mycobacterium bovi...
NP_249437  85 AYISIHNMAAWMLASFGDAALKEAWLPGLIGgeSLASYCLTEPDAGSDAARLRTRARRE----GDEYVLDGSKCFISGAG 160 Pseudomonas aerugi...
Feature 1                                             #                                       
AAH44203  199 DTDVYVVMCRTggk--gpKGISCLVVEKgtPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVTNRLg---tEGQGFSIAMK 273 zebrafish
Q9UKU7    197 ESDIYVVMCRTggp--gpKGISCIVVEKgtPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIg---sEGQGFLIAVR 271 human
NP_493832 183 TSNNYFVMMRQdgaapgaKGIFCLMIEDgtEGFSYGKKEDKLGWNSQPTRILTFEDCKVPITNQIg---kDGFGFNIAMA 259 Caenorhabditis ele...
NP_102846 170 DSDVYAVMVRTgad--gpKGISTIVVPKdaPGLSFGANEHKMGWHMQSTRQVIFEDCKVPAENLLs---gEGAGFGIAMA 244 Mesorhizobium loti
AAH56845  196 DTDVYVVMCRTggs--gaRGISCLVVEKgtPGLSFGKKEKKVGWNSQPTRAVIFEDCVVPVKNRLg---vEGQGFSIAMK 270 African clawed frog
NP_437985 161 ESGLYIVMARTgee--gpKGISAFVVEKdaPGLTFGANEKKMGWHAQPTRAVMLDNVRVSVENRLg---aEGEGFRIAMA 235 Sinorhizobium meli...
NP_420163 161 VSDIYVVMARTgge--gaKGVSAFVVEKgmEGLSFGANERKMGWNAQPTAQVNFDNCRVPVANRIg---qEGEGFRFAMM 235 Caulobacter cresce...
NP_854432 164 ASDVYVVMARTgae--gpRGVSAFVVEKgtPGLSFGAPEAKMGWHAQPTAQVVLDGVRVPAEAMLggadgEGAGFGIAMS 241 Mycobacterium bovi...
NP_249437 161 STQVLIVMARTged--gaRGISCFLVPAdaPGIRYGRNEDKMGWRAQPTRTITFEGVRIPAGNRIg---pEGQGFVYAMK 235 Pseudomonas aerugi...
Feature 1                                                                                     
AAH44203  274 GLNGGRINIASCSLGAAHASVLLARDHMCVRKQFGETLANSQFLQFKLAEMATKLVASRLLVRQAALALQDgrpDAVSLC 353 zebrafish
Q9UKU7    272 GLNGGRINIASCSLGAAHASVILTRDHLNVRKQFGEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEerkDAVALC 351 human
NP_493832 260 GLNGGRINIASCSLGAAQRSMDLAIEHLKYRKQFGKSLADFQYNQFKLAELATKLYTSRLIVRNAAEQLDNddpEKVALC 339 Caenorhabditis ele...
NP_102846 245 GLDGGRLNIAACSLGGAQSALDKALSYTAERKAFGSKINQFQALQFRLADMETELQAARIFLYAAASKLDRkapDAGKWS 324 Mesorhizobium loti
AAH56845  271 GLNGGRINIASCSLGAAHASVLLTRDHLAVRKQFGEPLAHNQYLQFKLADMATRLVTSRLIVRHAADALQNgtgDAATLC 350 African clawed frog
NP_437985 236 GLDGGRLSIAAASLGGAQSAFDKALAYVQERRAFGKAIGEFQALQFRLADMATDLEIARTFLWRAACALDAadpEATKLC 315 Sinorhizobium meli...
NP_420163 236 GLDGGRLNIASCSLGGAQFALDTAKAYLETRNQFGRPLKDFQALQFKLADMATELEAARLMVRRAAHALDSkhpEATKLC 315 Caulobacter cresce...
NP_854432 242 GLNGGRLNIAACSLGGAQAAFDKAGAYVRDRQAFGGSLLDEPTVRFTLADMATGLQTSRMLLWRAASALDDddaDKVELC 321 Mycobacterium bovi...
NP_249437 236 GLDGGRLNIASCSLGAAQAALEQSMRYVEEREQFGKPLATFQALQFKLADMLTELTASRQMVRLGAHRLDRgdaEATLYC 315 Pseudomonas aerugi...
Feature 1                                              #      # #             
AAH44203  354 SMAKLFVTDECFSICNQALQIHGGYGYLKDYAVQQYVRDIRVHQILEGTNEVMRMIIARSLLTE 417 zebrafish
Q9UKU7    352 SMAKLFATDECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE 415 human
NP_493832 340 AMAKLHATDNCFDVVNGALQMFGGYGFLKDYPVQQYLRDIRVHQILEGTNEMMRLLISRDLLTK 403 Caenorhabditis elegans
NP_102846 325 AMAKRFVTDTGFNVANNALQLLGGYGYLHDYGIEKLVRDLRVHQILEGTNEIMRVIIARALIGR 388 Mesorhizobium loti
AAH56845  351 AMAKLFATDECFKICNQALQMHGGYGYLKDYAVQQFVRDIRVHQILEGTNEVMRMIVARSILQE 414 African clawed frog
NP_437985 316 AMAKRFVTDRCFSVANDALQLHGGYGYLADYGVEKIVRDLRVHQILEGTNEIMRLIVSRAIMGR 379 Sinorhizobium meliloti
NP_420163 316 AMAKRFATDAGFQVANDALQLHGGYGYLQDYPLERLVRDLRVHQILEGTNEIMRVIIAREMFRQ 379 Caulobacter crescentus CB15
NP_854432 322 AMAKRYVTDTCFEVADQALQLHGGYGYLREYGLEKIVRDLRVHRILEGTNEIMRLVIGRAEAAR 385 Mycobacterium bovis subsp. bovis A...
NP_249437 316 AMAKRFATDRCFDVCNEALQLHGGYGYLNDYPLERWVRDTRVHQILEGTNEIMRVIVARRLLEQ 379 Pseudomonas aeruginosa PAO1

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap