Conserved Protein Domain Family
VLCAD

?
cd01161: VLCAD 
Very long chain acyl-CoA dehydrogenase
VLCAD is an acyl-CoA dehydrogenase (ACAD), which is found in the mitochondria of eukaryotes and in some bacteria. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. VLCAD acts as a homodimer.
Statistics
?
PSSM-Id: 173850
View PSSM: cd01161
Aligned: 7 rows
Threshold Bit Score: 627.959
Threshold Setting Gi: 10176110
Created: 26-Mar-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:FAD binding site [chemical binding site]
Evidence:
  • Comment:based upon similarity with other acyl-CoA dehydrogenases

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                     
Q9H845     38 AFAKELFLGkikkkEVFPFPevsq------delNEINQFLGPVEKFFTEEVDsrKIDQEGKi----pDETLEKLKSLGLF 107 human
BAA06331   72 SFAVGMFKGqlttdQVFPYPsvln-----egqtQFLKELVGPVARFFEEVNDpaKNDSLEKv----eEDTLQGLKELGAF 142 Norway rat
NP_495493  41 SFVMNLFRGkavtdQVFPYPlnmt-----deqkETLGMVMSPLEKMLVEVNDvvKNDETSDi----pRAVLDQFAELGTF 111 Caenorhabditis ele...
NP_611409  73 SFMANIFRGslvssQVFPYPdvlt-----aeqkELTNSLIDPFERFFSDVNDaaRNDANSKi----dDTTSTALWELGAF 143 fruit fly
AAH54606   77 SFAVNMFKGqistsQVFPYPsvln-----eeqsQFLRELVGPCSKFFEEVNDpmKNDALEKv----eEHTLQGLKEMGAF 147 zebrafish
BAB07205   13 SFLLDEIDAd---kVFTPEDf-----------tEEHEMIGKTTEEFVVNEVVp-VLDEIENhqfdisRRLLTQAGELGLL 77  Bacillus halodurans
NP_691735  11 KEVLRMKLTdk--rSLFPDErglevdsysinlnEDEQLISKTIHQLVEEKILp-NMDQLEDhdytlqKKRMKEVGQLGLM 87  Oceanobacillus ihe...
Feature 1                                                                            # ##    #
Q9H845    108 GLQVPEEYGGLGfsNTMYSRLGEIISM-DGSITVTLAAHQAIGLKGIILAGTEEQKAKYLPKLAsgeHIAAFCLTEPASG 186 human
BAA06331  143 GLQVPSELGGLGlsNTQYARLAEIVGMhDLGVSVTLGAHQSIGFKGILLYGTKAQKEKYLPRVAsgqALAAFCLTEPSSG 222 Norway rat
NP_495493 112 GVLVPPELEGSGfnNSQMARVAEIVGAyDLGFGVVMGAHQSIGYKGILLEGTDAQKQKYLPDLAtgrKFAAFALTEPTTG 191 Caenorhabditis ele...
NP_611409 144 GIQVPSEFGGLGlnNTQYGRLCAIVGVnDLGLGITIGAHQSIGFKGILLYGTPEQKEKYLPKVAaeqVYAAFALTEPSSG 223 fruit fly
AAH54606  148 GLQVPADLGGVGltNTQYARLVEIVGMhDLGVGITLGAHQSIGFKGILLFGNPQQKEKYLPKLAtgeNIAAFCLTEPASG 227 zebrafish
BAB07205   78 GADVPEEYGGLGldKISSSIITEKFSR-AGGFSLSYGAHVGIGSLPIVFFGNEDQKKKYLPDLAtgaRIAAYALTEPSSG 156 Bacillus halodurans
NP_691735  88 GAEVPEEYGGLEagKRMSGIIAEKMGY-AASFSVAFNIHSGVGTLPYVYFGNEAQKNQYLPKLAsgeWVGAYALTEPNAG 166 Oceanobacillus ihe...
Feature 1     #                         # #                                                   
Q9H845    187 SDAASIRSRATLSedKKHYILNGSKVWITNGgLANIFTVFAKTevvds-dgsvkDKITAFIVERDFGGVTNGKPEDKLGI 265 human
BAA06331  223 SDVASIRSSAVPSpcGKYYTLNGSKIWISNGgLADIFTVFAKTpikdaatgavkEKITAFVVERSFGGVTHGLPEKKMGI 302 Norway rat
NP_495493 192 SDASSVRTRAELSadGKHYVLNGGKIWISNGgFADVFTVFAQTpvkqa-dgstkDKMSAFIVERAFGGVTSGPQEKKMGI 270 Caenorhabditis ele...
NP_611409 224 SDAGSIRCRAVKSadGKHYVLNGSKIWISNGgIAEIMTVFAQTeqvdpktgekkDKVTAFIVERSFGGVTNGPPEKKMGI 303 fruit fly
AAH54606  228 SDAASIKTTAVRSpcGQYYTMNGSKIWISNGgTAEIFTVFAKTpvkdektgemkDKITAFIVERSFGGVSSGPPEKKMGI 307 zebrafish
BAB07205  157 SDALGAKTTAVLNeaGTHYVLNGEKQWITNSaFADVFIVYAKId---------gEHFSAFIVEKDFEGVSTGPEEKKMGI 227 Bacillus halodurans
NP_691735 167 SDALASKTTAKWNdeNQTWTINGEKQWITNAhIANVYVVFANTe----------QGITAFIVERTFKGVSIGPEEKKLGI 236 Oceanobacillus ihe...
Feature 1                                                                                     
Q9H845    266 RGSNTCEVHFENTKIPVENILGEVGDGFKVAMNILNSGRFSMGSVVAGLLKRLIEMTAEYACTRKQFNKRLSEFGLIQEK 345 human
BAA06331  303 KASNTSEVYFDGVKVPAENVLGEVGDGFKVAVNILNNGRFGMAATLAGTMKAIIAKAVDHATNRTQFGDKIHNFGVIQEK 382 Norway rat
NP_495493 271 KGSNTTEVHFDNLKIPVENLLGKEGEGFKVAMNILNNGRFGIPAACTGAMKHCIQKTVDHITTRVQFGKKLQEFGNIQEK 350 Caenorhabditis ele...
NP_611409 304 KASNTAEVYFEDVKIPIENVLGKEGDGFKVAMNILNNGRFGMGATLSGTMKKCIEQATEHANNRVQFGQKLKNYGSIQEK 383 fruit fly
AAH54606  308 KASNTAEVYFENVRVPADCVLGEVGGGFKVAMNILNNGRFGMAAALSGTMKGVITKAVDHAANRTQFGNKIHNYGAIQEK 387 zebrafish
BAB07205  228 KGSSTRTLILEDALVPKENLLGEVGKGHVIAFNILNVGRYKLGVGCIGGSKRGIELAAKYANERKQFKQPIAKFTLIQEK 307 Bacillus halodurans
NP_691735 237 KGSSTATLILEDVELDSAQVLGEVGKGHRIALNILNLARLKIAFSNIGMSKQALEFAIKYGKDRQQFGKNIVEFGLIQEK 316 Oceanobacillus ihe...
Feature 1                                                                                     
Q9H845    346 FALMAQKAYVMESMTYLTAGMLDQpgf-----------------pdcSIEAAMVKVFSSEAAWQCVSEALQILGGLGYTR 408 human
BAA06331  383 LARMAILQYVTESMAYMLSANMDQgfk------------------dfQIEAAISKIFGSEAAWKVTDECIQIMGGMGFMK 444 Norway rat
NP_495493 351 LVEMISKLYATESIVYMLSSNMDRgik------------------eyQLEAAIGKVLASENAWLVCDDAIQVHGGMGFMR 412 Caenorhabditis ele...
NP_611409 384 LAQMNILQYATESMAFTISQNMDAgsk------------------dyHLEAAISKIYASESAWYVCDEAIQILGGMGYMV 445 fruit fly
AAH54606  388 MARMAMLQYVTESMAYMVSGNMDSgat------------------efQIEAAISKIFASEAAWLVTDECIQVMGGMGFMK 449 zebrafish
BAB07205  308 LANMAVTTYAAESSIYRTGGLFEDrlgglseeqqkdgrevakaiaeyAIECSLNKVVGSEALDFVADEAVQIHGGYGFMA 387 Bacillus halodurans
NP_691735 317 IANMATAIYKSECTAYYTASLLDRqlidngken------fisslarfSMDCSINKVLASESLDMIVDEALQIHGGYGYMQ 390 Oceanobacillus ihe...
Feature 1                 #      # #               
Q9H845    409 dypYERILRDTRILLIFEGTNEILRMYIALTGLQHAG 445 human
BAA06331  445 epgVERVLRDIRIFRIFEGTNDILRLFVALQGCMDKG 481 Norway rat
NP_495493 413 etgLERVLRDLRIFRIFEGANDVLRLFIALTGAQHAG 449 Caenorhabditis elegans
NP_611409 446 dngLERVLRDLRIFRIFEGTNDILRLFIALTGIQYAG 482 fruit fly
AAH54606  450 dagVERVLRDLRIFRIFEGTNDILRLFVALNGFQNAG 486 zebrafish
BAB07205  388 eyeVERMYRDSRINRIFEGTNEINRLLVPGTILRKAM 424 Bacillus halodurans
NP_691735 391 eyeVERLYRDSRINRLFEGTSEINRLTIAKSFLKQYD 427 Oceanobacillus iheyensis HTE831

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap