1BUC,1JQI


Conserved Protein Domain Family
SCAD_SBCAD

?
cd01158: SCAD_SBCAD 
Click on image for an interactive view with Cn3D
Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases
Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers.
Statistics
?
PSSM-Id: 173847
View PSSM: cd01158
Aligned: 18 rows
Threshold Bit Score: 546.096
Threshold Setting Gi: 21219931
Created: 26-Mar-2010
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:FAD binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                       
1BUC_A        7 DIQQDFLKLAHDFGEKKLAPTVTERDHkgiydKELIDELLSLGItgayFEEKYGGSGddggdVLSYILAVEELAKYDAGV 86  Megasphaera elsd...
AAL13543     39 DDEKMMKETVAKLAQEQIQPLVKKMDFehkfdPSVLKAVFENGLmgieIDTELGGSGc---nFMTNIVVVEELSKIDPAV 115 fruit fly
XP_326398    57 EVETAMAETVQKFANDVILPKVRDMDEaeamdPAIVEQLFEQGImgveIPEEYGGAGm---nFTAAIVCIEELARIDPSV 133 Neurospora crassa
NP_394434     8 QDEELVLSFVRKFAEEELKPLAKEIDEkmevpRKIIDRMKDLGLfatyIPKEYGGYGm---sFPFLVRAIEEISKACPST 84  Thermoplasma aci...
NP_279692    24 AEHDQIAEMVAEFVDEEVKPRAATIDKadefpADLVAEMSDLGLmgmpFPEEYDGAGl---dYHTYATALSEIARGSGGL 100 Halobacterium sp...
P45954       59 DEEMMIKSSVKKFAQEQIAPLVSTMDEnskmeKSVIQGLFQQGLmgieVDPEYGGTGa---sFLSTVLVIEELAKVDASV 135 human
NP_625710    16 DEARDLISLVRDIAQREIVPSAAEEEDtgrfpREVFTLLSDSGLlglpYDAEFGGGEq---pYEVYLQVLEELAAARLTV 92  Streptomyces coe...
ZP_00019147   7 PEQQFIRQTVREFAEKEIAPKARYVDEhsafpSETFAKMAQLGLmglpFPEEYGGAGa---dSVSTAIAIEEVARCCGST 83  Chloroflexus aur...
NP_294979    12 SEQRMILQHVRDFCRAEIAPRAAEYDRsgeypREQLRGLAELGLlgatVPEEWGGAGl---dSVTYALCLEEIAAADSSV 88  Deinococcus radi...
NP_650840    29 ETHQMLQKSCRDFANNELSGNAAKFDRehlypEKQIRQMGELGVmavaIPEELGGTGl---dYVAYAIAMEEISRGCASA 105 fruit fly
Feature 1                                              #  #     #                        # #    
1BUC_A       87 AITLSATVsLCANPIWQFGTEAQKEKFLVPLVEGtKLGAFGLTEPNAGTDASGQQTIATKNdDGTYTLNGSKIFITNGgA 166 Megasphaera elsd...
AAL13543    116 AAFVDIHNtLVNSLMIKFGNAEQKAKYLPKLAQE-YAGSFALTEPGAGSDAFSLKTVAKKD-GSHYVINGSKMWISNSdV 193 fruit fly
XP_326398   134 SVMVDVHNtLVNTAVIRWGSEALKKKYLPKLATN-TVGSFCLSEPVSGSDAFALATRAVET-ENGYKINGSKMWITNSmE 211 Neurospora crassa
NP_394434    85 ALVLDGALtLFAEPLIMFGSEDLKKRYLPRVAAG-SVGGLAITEPGAGSDAAGISATAVKK-GDRYVINGDKIFISNGrI 162 Thermoplasma aci...
NP_279692   101 GTVVAAHTsLAGNMVYEYGSDDQKHDYLAPLSRGdDIGAFALSEAGAGSDVPAMETTAQRD-GDAYVISGEKLWISNGsV 179 Halobacterium sp...
P45954      136 AVFCEIQNtLINTLIRKHGTEEQKATYLPQLTTE-KVGSFCLSEAGAGSDSFALKTRADKE-GDYYVLNGSKMWISSAeH 213 human
NP_625710    93 GLGVSVHT-LASYALATYGTKEQQAEHLPAMLGGgLLGAYSLSEPASGSDAASLRTKAVREsGGDWVITGTKAWITHGgI 171 Streptomyces coe...
ZP_00019147  84 ALAYAAHLgLGSAPIAMFGTEEQKRRFLVPAAKGeYLAAFGLTEPHAGSDAGATRTTARLV-GDEWVINGQKMWITNApI 162 Chloroflexus aur...
NP_294979    89 AVIVSVQNgLPEQMILNYGTDAQREKYLRPLASGeHIGAFCLTEAHAGSDAASLRLKAERD-GDDWVLNGAKAWITSGnH 167 Deinococcus radi...
NP_650840   106 GVIMSVNNsLYLGPLLSFGNDAQKKDYITPFTTGeRVGCFALSEPGNGSDAGAASTIATDK-GDHFVLNGTKAWITNAfE 184 fruit fly
Feature 1                                                                                       
1BUC_A      167 ADIYIVFAMTdkskgnHGITAFILEDgt-pGFTYGKKEDKMGIHTSQTMELVFQDVKVPAENMLGeeGKGFKIAMMTLDG 245 Megasphaera elsd...
AAL13543    194 AGVFLIFANAkpedgyRGITTFIVDRet-pGLIVNKPEDKLGIRASGTCQLTFDNVRVPEENILGtfGHGYKYAAGFLNE 272 fruit fly
XP_326398   212 ADFFIVFANVdpskgyRGITAFIVEKgm-kGFSIAKKEKKLGIKASSTCVLNFDDVEVPKENILGkvGEGYKYAIGILNE 290 Neurospora crassa
NP_394434   163 SDFFVLDAVTdpgkrhRGITAFVADRdt-pGLKISRDIHKMGIRGSSTVELAFEDMEIPAENIVGkeNEGFKVIMETLDA 241 Thermoplasma aci...
NP_279692   180 ADTVTVFAKTdpdaghRGISSFIVRPaeddGFIVAGTEDKLGDKGCPTAELRFDDMRVPADRLLGeeGDGFKHALETLNG 259 Halobacterium sp...
P45954      214 AGLFLVMANVdptigyKGITSFLVDRdt-pGLHIGKPENKLGLRASSTCPLTFENVKVPEANILGqiGHGYKYAIGSLNE 292 human
NP_625710   172 ADFYTVMARTged-gpRGITAFLVPAda-eGLSAAVPEKKMGLKGSPTAQLHLDGVRVPDARRLGdeGQGFAIALSALDS 249 Streptomyces coe...
ZP_00019147 163 AGHIIVTAVTdpdlgkKGISAFIVPRgt-pGLSFGKHEPKMGLRGSVSTAVMLDDVRVPRENLLGerGRGFIQFLQVLDG 241 Chloroflexus aur...
NP_294979   168 ADTFLVMARTggp-gaRGVSCFIVERgt-pGLSSGKPEHKMGQHAAQTTTVSFDNVRVPHANLVGeeGQGLIIALSSLDS 245 Deinococcus radi...
NP_650840   185 AEAAIVFATTnkqlkhKGISAFIVPKat-kGFSLGKKEDKLGIRGSSTCQLIFEDCVVPKENMLGepGFGFKIAMQTLDA 263 fruit fly
Feature 1                                                                                       
1BUC_A      246 GRIGVAAQALGIAEAALADAVEYSKQ-RVQFGKPLCKFQSISFKLADMKMQIEAARNLVYKAACKKQEGkpFTVDAAIAK 324 Megasphaera elsd...
AAL13543    273 GRIGIAAQMVGLAQGTFDATIPYLLE-RKQFGDAIYNFQSMQHQIATVATEIEAARLMTYNAARLQEQGvpFQKEAAMAK 351 fruit fly
XP_326398   291 GRIGIGAQMTGLALGAWENAVKYVWNdRKQFGQLVGEFQGMQHQIAQSYTEIAAARALVYNAARKKEAGedFVMDAAMAK 370 Neurospora crassa
NP_394434   242 GRIGIAAQALGIAENALAEAIDYVKQ-RKQFGTEIANFEGIQFMIAEMATEIEAARYLTYVAAEKWQNKenTIEISAMAK 320 Thermoplasma aci...
NP_279692   260 GRITIAARSVGLARAALDDAREYAQD-RDQFGQAISDFQTIQHKLADMDTKLQAAELLMHKAADLKIRGesFIKEAAQAK 338 Halobacterium sp...
P45954      293 GRIGIAAQMLGLAQGCFDYTIPYIKE-RIQFGKRLFDFQGLQHQVAHVATQLEAARLLTYNAARLLEAGkpFIKEASMAK 371 human
NP_625710   250 GRLGIAACAIGVAQAALDEALSYATG-RRQFGKPIADFQGLRFMLADMATQIEAGRALYLTAARLRDAGlpFAKQAAMAK 328 Streptomyces coe...
ZP_00019147 242 GRIGIGAMAIGLAQAAYEAAVAYARE-RTAFGKPIGAHQSVANMIANMAVDLAAARALVYGAARLKDAGrpYTREAAIAK 320 Chloroflexus aur...
NP_294979   246 GRIGIGMLGLGIARSALEHAAAYANE-REQFGKKIREFEGVSFKIARMAARIESARLVGLKAAWLKDQGqpFSKEASIAK 324 Deinococcus radi...
NP_650840   264 GRIGIAGQALGIGQAALELAVDYAQK-RQAFGKPIAKLQSIQQKIADMSLAMESARLLTWRAAWLKDQKqpYTKEAAMAK 342 fruit fly
Feature 1                      #   #                      #                
1BUC_A      325 RVASDVAMRVTTEAVQIFGGYGYSEEYPVARHMRDAKITQIYEGTNEVQLMVTGGALLR 383 Megasphaera elsdenii
AAL13543    352 YYASEVAQRAAIKCVDWMGGVGFTRDFPQEKYYRDVKIGAIYEGTTNMQLSTIAKCIKK 410 fruit fly
XP_326398   371 LYASQVAGRVSGLAVEWMGGMGFVREGLAEKFFRDSKIGAIYEGTSNIQLNTIAKTLQK 429 Neurospora crassa
NP_394434   321 MKASDVAMRVTTDALQLFGGYGYTTDLDAERHMRDAKITQIYEGTNQIQRLVIAKEILK 379 Thermoplasma acidophilum
NP_279692   339 LYASEISREVANEGIQIHGGYGYTKDFDAERYYRDAKLNEIYEGTSEILRNTIANELLE 397 Halobacterium sp. NRC-1
P45954      372 YYASEIAGQTTSKCIEWMGGVGYTKDYPVEKYFRDAKIGTIYEGASNIQLNTIAKHIDA 430 human
NP_625710   329 LHCTDTAMRVTHDAVQILGGYGYTADFPAERYMREAKVLQIVEGTNQIQRMVIARHLAG 387 Streptomyces coelicolor A3(2)
ZP_00019147 321 LFASEASERICRDAIQVFGGYGYSQEYPVERLYRDTRLLTIGEGTSEILRGVIAHSVLG 379 Chloroflexus aurantiacus
NP_294979   325 LLGSEAAVDVTRDAVQIFGGNGYSAEYPVEKLYRDAKITEIYEGTSEIQQLVISRAVFA 383 Deinococcus radiodurans R1
NP_650840   343 LAASEAATLCSHQCIQILGGMGYVTDMAAERHYRDARITEIYEGTSEIQRLVIAGSILK 401 fruit fly

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap