3MDE,1EGE


Conserved Protein Domain Family
MCAD

?
cd01157: MCAD 
Click on image for an interactive view with Cn3D
Medium chain acyl-CoA dehydrogenase
MCADs are mitochondrial beta-oxidation enzymes, which catalyze the alpha,beta dehydrogenation of the corresponding medium chain acyl-CoA by FAD, which becomes reduced. The reduced form of MCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. MCAD is a homotetramer.
Statistics
?
PSSM-Id: 173846
View PSSM: cd01157
Aligned: 5 rows
Threshold Bit Score: 732.85
Threshold Setting Gi: 2833314
Created: 26-Mar-2010
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 21 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                     
3MDE_A      6 LTEQQKEFQATARKFAREEIIPVAAEYDRTGEYPVPLLKRAWELGLMNtHIPESFGGLGlgIIDSCLITEELAYGCTGVQ 85  pig
1EGE_A     16 FTEQQKEFQATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNtHIPENCGGLGlgTFDACLISEELAYGCTGVQ 95  human
Q22347     31 LSETQKEIQDAALKFSKDVLVPNAAKFDESGEFPWEIVRQAHSLGLMNpQIPEKYGGPGmtTLETALIVEALSYGCTGIQ 110 Caenorhabditis ele...
AAH45911   44 LTEQQKEFQEVARKFAREEIVPAAPSYDRSGEYPFPLIKRAWELGLMNgHIPEDCGGMGqgIFDACLITEELAYGCTGVQ 123 zebrafish
Q9VSA3     37 LTEDQLQLQELARKFTREEIIPVAAQYDKSGEYPWPIIKKAWELGLMNnHIPADIGGLDldVFTTCLSAEELAYGCTGIM 116 fruit fly
Feature 1        #   #                             # ##    ##                       # #       
3MDE_A     86 TAIEANTLGQVPLIIGGNYQQQKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKGDEYIINGQKMWITNGGKANW 165 pig
1EGE_A     96 TAIEGNSLGQMPIIIAGNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKGDEYIINGQKMWITNGGKANW 175 human
Q22347    111 LGIMGPSLAIAPVYISGNEEQKKKYLGALAAEPIIASYCVTEPGAGSDVNGVKTKCEKKGDEYIINGSKAWITGGGHAKW 190 Caenorhabditis ele...
AAH45911  124 TAIEANSLGQMPVIIAGNDAQRKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTRAVKKGDDYVINGQKMWITNGGKANW 203 zebrafish
Q9VSA3    117 TALEASGLGQTPVILSGNKEQKKKYLGRLLEEPLVAAYCVTEPGAGSDVSGIKTRAEKKGDEWVINGQKMWITNGGVANW 196 fruit fly
Feature 1                                                                          #      ##  
3MDE_A    166 YFLLARSDPDPKAPasKAFTGFIVEADtPGVQIGRKEINMGQRCSDTRGIVFEDVRVPKENVLtgEGAGFKIAMGTFDKT 245 pig
1EGE_A    176 YFLLARSDPDPKAPanKAFTGFIVEADtPGIQIGRKELNMGQRCSDTRGIVFEDVKVPKENVLigDGAGFKVAMGAFDKT 255 human
Q22347    191 FFVLARSDPNPKTPagKAFTAFIVDGDtPGITRGKKEKNMGQRCSDTRVITFEDVRVPAENVLgaPGAGFKVAMEAFDMT 270 Caenorhabditis ele...
AAH45911  204 YFLLARTDSDPKCPasKAFTGFIVDADtPGVQPGRKELNMGQRCSDTRGITFEDVVIPKENVLigEGAGFKIAMGAFDKT 283 zebrafish
Q9VSA3    197 YFVLARTNPDPKCPpsKAFTGFIVERDsPGLTPGRKELNMGQRASDTRGITFEDVRVPKENVLigEGAGFKIAMGTFDKT 276 fruit fly
Feature 1     #                                                                   # #         
3MDE_A    246 RPPVAAGAVGLAQRALDEATKYALERKTFGKLLAEHQGISFLLADMAMKVELARLSYQRAAWEIDSgrRNTYYASIAKAY 325 pig
1EGE_A    256 RPVVAAGAVGLAQRALDEATKYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSgrRNTYYASIAKAF 335 human
Q22347    271 RPGVAAGALGLSWRCLDESAKYALERKAFGTVIANHQAVQFMLADMAVNLELARLITYKSANDVDNkvRSSYNASIAKCF 350 Caenorhabditis ele...
AAH45911  284 RPPVAAGATGLAQRALEEATKYAMERKTFGKFIAEHQAVSFLLAEMAMKVELARMAYQRAAWEVDMgrRNTYYASIAKAF 363 zebrafish
Q9VSA3    277 RPPVAAGAVGLAQRCLDEALKYALERKTFGVPIAYHQAVQFMLADMAIGVETSRLAWRLSAWEIDQgrRNSYYASIAKCH 356 fruit fly
Feature 1                                        #  ### # #             
3MDE_A    326 AADIANQLATDAVQVFGGNGFNTEYPVEKLMRDAKIYQIYEGTAQIQRIIIAREHIGR 383 pig
1EGE_A    336 AGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQIYEGTSQIQRLIVAREHIDK 393 human
Q22347    351 AADTANQAATNAVQIFGGNGFNSEYPVEKLMRDAKIYQIYEGTSQIQRIVISRMLLGH 408 Caenorhabditis elegans
AAH45911  364 AGDIANQCASDAVQIFGGNGFNSEYPVEKLMRDAKIYQIYEGTAQIQRLIISREVLGK 421 zebrafish
Q9VSA3    357 AADMANKIASDAVQIFGGNGFNSEYPVEKLMRDAKIYQIYEGTSQIQRLIISRNMYEA 414 fruit fly

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap