Conserved Protein Domain Family
GCD

?
cd01151: GCD 
Glutaryl-CoA dehydrogenase
Glutaryl-CoA dehydrogenase (GCD). GCD is an acyl-CoA dehydrogenase, which catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and carbon dioxide in the catabolism of lysine, hydroxylysine, and tryptophan. It uses electron transfer flavoprotein (ETF) as an electron acceptor. GCD is a homotetramer. GCD deficiency leads to a severe neurological disorder in humans.
Statistics
?
PSSM-Id: 173840
View PSSM: cd01151
Aligned: 11 rows
Threshold Bit Score: 624.767
Threshold Setting Gi: 28829336
Created: 26-Mar-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
Feature 1:FAD binding site [chemical binding site]
Evidence:
  • Comment:based on similarity to other ACAD's

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                     
Q92947     48 FDWQDPLVLEEQLTTDEILIRDTFRTYCQERLMPRILLANRNEvf--hREIISEMGELGVLGp-tIKGYGCAGvsSVAYG 124 human
NP_104115   8 FVWEDPFLIEDQLSEEERMVRDGAAAFAADKLAPRIEDAYLNEkt--dAGIFREMGEAGLLGitiPEEYGGLGanYVTYG 85  Mesorhizobium loti
XP_331067  43 FNWEDPLNHKSLLTEDEIAIGETAERYCQEQLFPRVLQAYRDEhy--dPKILEEMGDLGLLGa-tIEGYGCAGvsSVASG 119 Neurospora crassa
NP_609040  29 FNWQDPLNLESQLTEEEVAIRDAFRGYCQAELQPRVKMANRLEtf--dKKIMEEIGSLGVLGc-tIKGYGCAGvsSVAYG 105 fruit fly
Q20772     20 TFYQDAFQLSDQLTEDERSLMLSAREYCQERLLPRVTEAYRTEkf--dPSLIPEMGSMGLLGa-pYQGYGCAGtsTVGYG 96  Caenorhabditis ele...
NP_069824   2 FRGVDFYNVDELLSDEDRLVRQSVREFLEKEVVPLVADAWHEEkplnfHELGKKFGELGMLGtflPEEYGCPGmtYTTFG 81  Archaeoglobus fulg...
NP_249138   7 FNWEDPLLLDQQLTEEERMVRDSAQQFAQDKLAPRVLEAFRHEqt--dPKIFREMGETGLLGatiPEAYGGSGlnYVCYG 84  Pseudomonas aerugi...
NP_887213  17 FVWEDPFLLHEQLTEDERMIQATAHAYGQEQLLPRIVHAHRTEtf--dRKIFLELGQLGFLGa-tLEGYGCAGvnHVSYG 93  Bordetella bronchi...
NP_334820  10 LDRDDPLGLDASLSSDEIAVRDTVRRFCAEHVTPHVAAWFEDGdlpvaRDLAKQFGELGLLGm-qLHGHGCGGasAVHYG 88  Mycobacterium tube...
AAB18129   43 PCTSDYYHFNDLLTPEEQAIRKKVRECMEKEVAPIMTEYWEKAef--pFHITPKLGAMGVAGg-sIKGYGCPGlsITANA 119 thale cress
AAO51878   24 PSATDFFDFDGLLTEKELAIRKKAEKFAKEEINSLNINEYYERae-fpLPIIERLKGLNWVGa-nIKGYGSPEltSMELG 101 Dictyostelium disc...
Feature 1                                                         # ##    ##                  
Q92947    125 LLARELERVDSGYRSAMSVQSSLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRAHYNs-sNKS 203 human
NP_104115  86 LVAREVERVDSGYRSMMSVQSSLVMYPIHAYGSDEQRKKYLPKLASGEWIGCFGLTEPDAGSDPGGMKTRAEKT---ANG 162 Mesorhizobium loti
XP_331067 120 LITRAVERVDSGYRSGMSVQSSLVMGPINDFGTAEQKERFLPGMAKGKIIGAFGLTEPNHGSDPGSMETVARPHptkEGV 199 Neurospora crassa
NP_609040 106 LLTREVERVDSAYRSAVSVQSSLAMGAIYDFGSEEQKQRYLPSMAEGKLIGAFGLTEPNHGSDPAGMETRAKYDs-kSKT 184 fruit fly
Q20772     97 LIAREVERVDSGYRSTMSVQTSLVIGPIYNYGSEDQKQKYIPDLASGKKIGCFGLTEPNHGSNPGGMETKATWDe-tTKT 175 Caenorhabditis ele...
NP_069824  82 VVCQEVERVDSALRSFVAVTSGLVMYPIWRYGSEEQKGEYLPKLARGEIIGAFGLTEPNHGSDPGSMEATARRD---GDE 158 Archaeoglobus fulg...
NP_249138  85 LIAREVERVDSGYRSMMSVQSSLVMVPIHEFGNEATRQKYLPKLASGEYIGCFGLTEPNHGSDPGSMVTRAKKV---DGG 161 Pseudomonas aerugi...
NP_887213  94 LIGREMERVDSAYRSSVSVQSSLVMYPIHTFGSEEQRQTYLPGLASGELVGCFGLTEPDHGSDPGGMATRARGV---AGG 170 Bordetella bronchi...
NP_334820  89 LACRELEAADSGIRSLVSVQGSLAMFAIASFGSDEQKRQWLPGMATGDLLGCFGLTEPDVGSDPAAMKTRARRD---GPD 165 Mycobacterium tube...
AAB18129  120 IATAEIARVDASCSTFILVHSSLGMLTIALCGSEAQKEKYLPSLAQLNTVACWALTEPDNGSDASGLGTTATKV---EGG 196 thale cress
AAO51878  102 LIAMEISKSSADIATFYTILLNITMLAIYYSGSEQQKQYYLPKMTSLEKIGAFALTEPEAGSDAAGLKCTAKQLp-nGAG 180 Dictyostelium disc...
Feature 1             # #                                                                     
Q92947    204 YTLNGTKTWITNSpMADLFVVWARCe----dGCIRGFLLEKgm-----rGLSAPRIQGKFSLRASATGMIIMDGVEVPEE 274 human
NP_104115 163 YKLSGSKMWISNApIADVFVVWAKLkgetgkDEIRGFVLEKgm-----kGLSAPKIGGKLSLRASITGEVVMEGVEVGED 237 Mesorhizobium loti
XP_331067 200 YLLSGSKTWITNSpIADVLVVWAKLqe---tGKIRGFLVERsac--ppgTLETPQIKNKTGLRASITGMIQLDNCPVPKE 274 Neurospora crassa
NP_609040 185 YILNGSKTWITSApIADVIVVWAKCe----dGKVRGFLVDRkis---gkGLETPKIEGKFSLRASPTGMILMDEVRVPEE 257 fruit fly
Q20772    176 YKLNGSKTWISNSpVSDVMVVWARSar--hnNKIKGFILERgm-----kGLTTPKIEGKLSLRASITGQIAMDDVPVPEE 248 Caenorhabditis ele...
NP_069824 159 WVLNGTKTWISEAdVADIAVVWARDve---dGKIKGFIVERgt-----kGFQQTAITKKASMRAGSVGELGLVNCRVPEE 230 Archaeoglobus fulg...
NP_249138 162 YRLSGSKMWITNSpIADVFVVWAKDd----eGQIRGFVLEKgw-----eGLSAPAIHGKVGLRASITGEIVMDNVFVPEE 232 Pseudomonas aerugi...
NP_887213 171 YRLSGAKSWITNSpIADVFLIWAKDd----aGDIRGFILDRgm-----qGLSTERIDGKFSLRASITGTIAMDEVFVPQD 241 Bordetella bronchi...
NP_334820 166 WVITGGKMWITNGsVADVAIVWAATd-----DGIRGFIVPTdt-----pGFTANTIGHKLSLRASITSELVLDNVRLPAD 235 Mycobacterium tube...
AAB18129  197 WKINGQKRWIGNStFADLLIIFARNtt---tNQINGFIVKKda-----pGLKATKIPNKIGLRMVQNGDILLQNVFVPDE 268 thale cress
AAO51878  181 WILNGEKRWIGNApMADIIVIWARNid---tNKIHGFILEPskvasggdQLRIETLQKKFAFRSVQNGHIFMKDCFIAED 257 Dictyostelium disc...
Feature 1                                                                                     
Q92947    275 n-vLPGASSLGGPFGCLNNARYGIAWGVLGASEFCLHTARQYALDRMQF-GVPLARNQLIQKKLADMLTEITLGLHACLQ 352 human
NP_104115 238 a-lLPNAKGLGGPFGCLNRARYGISWGSMGAAEDCWHRARQYGLDRKQF-GKPLAGTQLYQKKLADMQTEIALGLQASLR 315 Mesorhizobium loti
XP_331067 275 n-mFPEIEGLKGPFTCLNSARFGIAFGMMGALEDCLARARTYALERKQFkGNPLAKYQLVQKKLAEAATDVAYGTLAAIQ 353 Neurospora crassa
NP_609040 258 q-lLPNVAGFSGPFSCLNNARYGIAWGALGAAETCVEIARQYTLDRKQF-GRPLAANQLIQKKLADAITEIALGLQACLH 335 fruit fly
Q20772    249 n-lLPNAEGLQGPFGCLNNARLGIAWGALGAAEECFHLARQYTLDRQQF-GRPLAQNQLMQLKMADMLTEISLGLQGCLR 326 Caenorhabditis ele...
NP_069824 231 n-rLPEARGLGAPLSCLNQARFGISWGAIGAAMDCYETALNYTKERKQF-GAPLASYQLVQEKLVNMLIEITKGQLLAWR 308 Archaeoglobus fulg...
NP_249138 233 n-aFPEVRGLRGPFTCLNSARYGISWGALGAAEFCWHTARQYVLDRQQF-GRPLAANQLIQKKLADMQTEITLALQGCLR 310 Pseudomonas aerugi...
NP_887213 242 r-mLPHVKGLRGPFSCLNKARLGISWGALGAAEACLHQARDYVLARTQF-GRPLASNQLVQKKLADMETEIAIGLQASLQ 319 Bordetella bronchi...
NP_334820 236 a-mLPGATGLRAPLACLSEARYGIVWGAMGAARSAWQCALDYARQRTQF-GRPIAGFQLTQAKLVDMAVELHKGQLLSLH 313 Mycobacterium tube...
AAB18129  269 d-rLPGVNSFQDTSKVLAVSRVMVAWQPIGISMGIYDMCHRYLKERKQF-GAPLAAFQLNQQKLVQMLGNVQAMFLMGWR 346 thale cress
AAO51878  258 qrlTNALDFNSGPGKCLFLTRIVVGWIALGVASNAYEKCLQYVKQRNQF-GQPLAQFQLVQERLVKMCSNIQAISLMCHR 336 Dictyostelium disc...
Feature 1                                                             #      # #              
Q92947    353 LGRLKDQdkaaPEMVSLLKRNNCGKALDIARQARDMLGGNGISDeYHVIRHAMNLEAVNTYEGTHDIHALILGRAITGIQ 432 human
NP_104115 316 VGRLLDAgkmaPEMISIVKRNNCGKALDIARQARDMHGGNGIQIgYHVMRHAQNLETVNTYEGTHDVHALILGRAQTGIQ 395 Mesorhizobium loti
XP_331067 354 VGRLKDEgkatPEMISMIKRQNCDRTLYHARTLQEIFGGNAVSDeYHIGRVVANLYVTQTYEGQSDIHSLILGRAITGVQ 433 Neurospora crassa
NP_609040 336 VGRLKDQklhtPDMISLLKRNNTGKSLDIARQMRDMLGANGISDeYHVIRHVINLESVNTYEGTHDIHALILGRAITGLA 415 fruit fly
Q20772    327 VSRLKDEgkvqSEQISIIKRNSCGKALEVARKARDMLGGNGIVDeYHIMRHMVNLETVNTYEGTHDVHALILGRAITGLN 406 Caenorhabditis ele...
NP_069824 309 LAKLMDEgkatTEQISMAKKNNVRVARYCARTARELLGANGISLdYSPIRHMANIESVYTYEGTDDIHTLILGRAITGYQ 388 Archaeoglobus fulg...
NP_249138 311 LGRMKDEgtaaVEITSIMKRNSCGKALDIARLARDMLGGNGISDeFGIARHLVNLEVVNTYEGTHDVHALILGRAQTGIQ 390 Pseudomonas aerugi...
NP_887213 320 VARLMDQgrvsTEAISIIKRNNCGKALEISRVARDMLGANGVSDeYHIIRHMINLEAVNTYEGTHDIHALIVGRAITGIQ 399 Bordetella bronchi...
NP_334820 314 LGRLKDRvglrPDQVSFGKLNNTREALKICRTARTILGGNGISLeYPVIRHMVNLESVLTYEGTPEMHQLVLGQAFTGLA 393 Mycobacterium tube...
AAB18129  347 LCKLYETgqmtPGQASLGKAWISSKARETASLGRELLGGNGILAdFLVAKAFCDLEPIYTYEGTYDINTLVTGREVTGIA 426 thale cress
AAO51878  337 VSQLFDQgklsSGQVGLLKAFSTSKAREVVSMARELFGGNGILL-DDIGRNFLDMEGIYTFEGTYDVNTLIAAREITGLS 415 Dictyostelium disc...
Feature 1       
Q92947    433 AF 434 human
NP_104115 396 AF 397 Mesorhizobium loti
XP_331067 434 AF 435 Neurospora crassa
NP_609040 416 AF 417 fruit fly
Q20772    407 GF 408 Caenorhabditis elegans
NP_069824 389 AF 390 Archaeoglobus fulgidus DSM 4304
NP_249138 391 AF 392 Pseudomonas aeruginosa PAO1
NP_887213 400 AF 401 Bordetella bronchiseptica
NP_334820 394 AF 395 Mycobacterium tuberculosis CDC1551
AAB18129  427 SF 428 thale cress
AAO51878  416 AI 417 Dictyostelium discoideum

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap