2CLB


Conserved Protein Domain Family
DPSL

?
cd01052: DPSL 
Click on image for an interactive view with Cn3D
DPS-like protein, ferritin-like diiron-binding domain
DPSL (DPS-like). DPSL is a phylogenetically distinct class within the ferritin-like superfamily, and similar in many ways to the DPS (DNA Protecting protein under Starved conditions) proteins. Like DPS, these proteins are expressed in response to oxidative stress, form dodecameric cage-like particles, preferentially utilize hydrogen peroxide in the controlled oxidation of iron, and possess a short N-terminal extension implicated in stabilizing cellular DNA. This domain is a member of a broad superfamily of ferritin-like diiron-carboxylate proteins. These proteins are distantly related to bacterial ferritins which assemble 24 monomers, each of which have a four-helix bundle with a fifth shorter helix at the C terminus and a diiron (ferroxidase) center. Ferritins contain a center where oxidation of ferrous iron by molecular oxygen occurs, facilitating the detoxification of iron, protection against dioxygen and radical products, and storage of iron in the ferric form. Many of the conserved residues of a diiron center are present in this domain.
Statistics
?
PSSM-Id: 153111
View PSSM: cd01052
Aligned: 18 rows
Threshold Bit Score: 174.786
Threshold Setting Gi: 206896120
Created: 24-Sep-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
diiron binding
Conserved site includes 6 residues -Click on image for an interactive view with Cn3D
Feature 1:diiron binding motif [ion binding site]
Evidence:
  • Comment:Many of the conserved residues of a diiron center are present in the DPSL domain.
  • Citation:PMID 8749363

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                         #                                 #  #                         
2CLB_A        20 GLDIKKLVDKLVKATAAEFTTYYYYTILRXHLTGXe-GEGLKEIAEDARLEDRLHFELXTQRIYELGGGLPRDIRQLadi 98  Sulfolobus solf...
AAK66802      18 GLNVDKLVKQLITNASVEFTAYYYFTNLRMHCTGMe-GEGIKGIIEDARLEDLSHFESCIERIFQLGGSLPNDAQAFtkm 96  uncultured cren...
NP_147956     12 GAKKDEIIKRLLSAFADEWVAGYYYMYTALAVKGPhaETISEIFMKEAEEEIGKHAKMIAERLQDFDVDPPRDFAKLyei 91  Aeropyrum pernix
NP_560195      7 PVDKQKIINMLLSAYADEWIAAYYYTLTAYAIKGPlsEEVAEHFLEEAKEELEKHARLIADRLQDFDIDPPRDFTKLwei 86  Pyrobaculum aer...
NP_623776     10 GGHADKIIEMLNKAFADEWLAYYQYWIGAKIARGPm-GEAVAAELAEHAGEELEHAEKLAERIIQLGGTPIIKPEDWykl 88  Thermoanaerobac...
NP_662215     10 GDSIDRVLELLNKAFADEWLAYYQYWIGAKIVEGPm-KDAVIAELVQHAADELRHADMVSMRIIQLGGTPLTSPKQWfew 88  Chlorobium tepi...
NP_812734     12 KLDVESLISQLNAALSEEWLAYYQYWVGALVVEGAm-RADVQGEFEEHAEEERRHAQLLADRIIELEGVPVLDPKKWfel 90  Bacteroides the...
YP_875423     18 GLDVDALIKQLVINSSVEFAAYYYFTLLRAHCVGVe-GEGIKYVIEDARMEDLSHFESSIARIYQLGGTLPIDPIDYikm 96  Cenarchaeum sym...
YP_394269     11 GLEISEIITILNRAYADEWLAYYQYFIEAKVVKGIm-KDAAIAELTQHAADELRHANMVADRILQLGGTPLLNPKDWfth 89  Sulfurimonas de...
YP_001996307  10 QLDVNELISKLNEALSEEWLAFYQYWVGARLMEGPm-RSEIEPELLIHADQELNHAVQIVNRIIQLGGTPVMSPQDWmkl 88  Chloroherpeton ...
Feature 1                                 #                               #  #        
2CLB_A        99 sacsdaYLPENWKDPKEILKVLLEAEQCAIRTWKEVCDXTYGKDPRTYDLAQRILQEEIEHEAWFLELL 167 Sulfolobus solfataricus
AAK66802      97 sgceflQLPKNPTDIKAILEKCLKAEQGAIVNWDIVCKMTYNKDPATYDIAKDILMEEIEHESWFLELL 165 uncultured crenarchaeote 4B7
NP_147956     92 sgckypPLPEDPYDVDGFIIAAVKAEICAIKAYKELFDLTHGTDPATEELAEDLLRDETRHRTELVNLL 160 Aeropyrum pernix
NP_560195     87 sgckypPIPNDPYDIDGWIAAAVKAEECAIRAYKELYQYTHGRDPVTEELAEEILRDEVKHRTDLINLL 155 Pyrobaculum aerophilum str...
NP_623776     89 t--ncgYDAPDNPDVKVLLEQNIKGEQCAIEVYNKMLSELKDIDPVTYHLVLEILEDEIEHEEDLETLK 155 Thermoanaerobacter tengcon...
NP_662215     89 t--ncgYEAPDDKFVKMILEQNISGEQCAITTYNSIIQEIGMKDPVTYNLAVQILQDEVTHEEDLQALL 155 Chlorobium tepidum TLS
NP_812734     91 a--rckYDAPQGFDSVSLLKDNVASERCAILRYQEIADFTNGKDFTTCDIAKHILAEEEEHEQDLQDYL 157 Bacteroides thetaiotaomicr...
YP_875423     97 sgceflQLPKKRTDHMEIMKKCLKAEQGAIVNWLKVCKMTEGKDPMTYDIAKDILAEEIEHESWFLELI 165 Cenarchaeum symbiosum A
YP_394269     90 t--ncgYEEPTHFDVVNILQDSIKGEQCAISIYSTLVDMTRDKDIVTYDIVSQILADEVEHEEDLQALH 156 Sulfurimonas denitrificans...
YP_001996307  89 s--scdYDAPTDPYVEVILEQNLKGERCAIKRYSELANMTNGKDHTTHQIVTTILNEELEHEQDIEDWI 155 Chloroherpeton thalassium ...

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap