1JKV,2CWL


Conserved Protein Domain Family
Mn_catalase

?
cd01051: Mn_catalase 
Click on image for an interactive view with Cn3D
Manganese catalase, ferritin-like diiron-binding domain
Manganese (Mn) catalase is a member of a broad superfamily of ferritin-like diiron enzymes. While many diiron enzymes catalyze dioxygen-dependent reactions, manganese catalase performs peroxide-dependent oxidation-reduction. Catalases are important antioxidant metalloenzymes that catalyze disproportionation of hydrogen peroxide, forming dioxygen and water. Manganese catalase, a nonheme type II catalase, contains a binuclear manganese cluster that catalyzes the redox dismutation of hydrogen peroxide, interconverting between dimanganese(II) [(2,2)] and dimanganese(III) [(3,3)] oxidation states during turnover. Mn catalases are found in a broad range of microorganisms in microaerophilic environments, including the mesophilic lactic acid bacteria (e.g., Lactobacillus plantarum) and bacterial and archaeal thermophiles (e.g., Thermus thermophilus and Pyrobaculum caldifontis). L. plantarum and T. thermophilus holoenzymes are homohexameric structures; each subunit contains a dimanganese active site. The manganese ions are linked by a mu 1,3-bridging glutamate carboxylate and two mu-bridging solvent oxygens that electronically couple the metal centers. Several members of this CD lack the C-terminal strands that pack against the neighboring catalytic domains as seen in L. plantarum. One such sequence, Bacillus subtilis CotJC, is known to be a component of the inner spore coat that interacts with spore coat protein, CotJA. It has been suggested that CotJC could modulate the degree of Mn SodA-dependent cross-linking of an outer coat component, or the two enzymes could serve to protect specific cellular structures during the developmental process.
Statistics
?
PSSM-Id: 153110
View PSSM: cd01051
Aligned: 37 rows
Threshold Bit Score: 188.939
Threshold Setting Gi: 171909618
Created: 24-Sep-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
dimanganese
Conserved site includes 5 residues -Click on image for an interactive view with Cn3D
Feature 1:dimanganese center [ion binding site]
Evidence:
  • Structure:1JKV; Lactobacillus plantarum Mn catalase, (3,3) oxidation state: hydrogen peroxide analog (azide) - inhibited complex
    View structure with Cn3D
  • Comment:The dinuclear manganese active site performs a two-electron catalytic cycle, interconverting between reduced (Mn[II]Mn[II]) and oxidized (Mn[III]Mn[III]) states during turnover.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                           #                                   #  #     
1JKV_A         1 MFKHTRKLQYNAK-PDRSDPIMARRLQESLGGQWGETTGMMSYLSQGWas-----tgAEKYKDLLLDTGTEEMAHVEMIS 74  Lactobacillus p...
2CWL_A         1 MFLRIDRLQIELPmPKEQDPNAAAAVQALLGGRFGEMSTLMNYMYQSFnfrg--kkaLKPYYDLIANIATEELGHIELVA 78  Thermus thermop...
NP_241935      1 MFKRIDKLLIDLPkPDHPDANAAAAVQELLGGRFGEMSTLNNYMYQSFnfrq--khkLRPFYELVASITAEEFGHVELVS 78  Bacillus halodu...
BAB97198       1 MYLRIDRLQIQLPaPKEPDPNAAAAVSELLGGRFGEMNTLMTYTYQSFnfrmhknpaIKPFRDLVSNIATEELGHIELVS 80  Pyrobaculum cal...
NP_845456      1 MFYYKEELINMIK-PDKPDPAAAKVLQEILGGHYGEMRTMMQYFFQSSnfr----gkEKQYRDLLRGVFLEEISHVELVQ 75  Bacillus anthra...
CAE09059       1 MFLRIDRLQIELPmPKEQDPNAAAAVQALLGGRFGEMSTLMNYMYQSFnfrg--kkaLKPYYDLIANIATEELGHIELVA 78  Thermus thermop...
NP_560191      1 MYLRIDRLQIELPaPKEPDPNAAAAVQELLGGRFGEMNTLMTYTYQSFnfrlhknpaLKPFRDLVANIATEELGHIELVS 80  Pyrobaculum aer...
BAF81110       1 MFLRIDRLQIELPmPKEQDPNAAAAVQALLGGRFGEMSTLMNYMYQSFnfrg--kkaLKPYYDLIANIATEELGHIELVA 78  Metallosphaera ...
YP_001641664   1 MFMRVDKLQAELPaPKRKDPNAAAALQELLGGKYGEMSTLGNYMFQSFnfrs--kdkLKPFYSLVSSITAEELGHVELVS 78  Methylobacteriu...
YP_002566105   1 MFYHDDQLQFEVE-VENPDPHFAKMLQQAIGGAEGEIRVALQYMFQAFavp----aeKQEIRQFLMETATEELGHIEMLA 75  Halorubrum lacu...
Feature 1                                                                                     #  
1JKV_A        75 TMIGYLLEdapfgpedlkrdpslattm----agmdpehslvhglnaslnNPNGAAWNAGYVTSSGNLVADMRFNVVRESE 150 Lactobacillus p...
2CWL_A        79 ATINSLLAknpgkdleegvdpesaplgf-akdvrnaahfiagganslvmGAMGEHWNGEYVFTSGNLILDLLHNFFLEVA 157 Thermus thermop...
NP_241935     79 NTINLMIEgttfpgdpditpmqdakd------krntyhfistaqtsypmDSMGASWRGDYVVNSGNLIFDLLHNYFLEIG 152 Bacillus halodu...
BAB97198      81 AVVNALYVgstkpappdqaplkplkd------vrntyhaintglgafpmDSHGTPWRGDYIFVSGNLVLDFLYNFFLEVG 154 Pyrobaculum cal...
NP_845456     76 HTINQLLTgsgeptpgnagidtapldea--vkhanphhfivgaqsslpvDAAGNPWNGSWVYSHGNLISDLLDNVVLEST 153 Bacillus anthra...
CAE09059      79 ATINSLLAknpgkdleegvdpastplgf-akdvrnaahfiagganslvmGAVGEHWNGEYVFTSGNLILDLLHNFFLEVA 157 Thermus thermop...
NP_560191     81 AVVNALYVgatkpgppesaplkplkd------arntyhatmtgltafpfDSHGAPWKGEYIFVSGNLVLDFLYNFFLEVG 154 Pyrobaculum aer...
BAF81110      79 ATINSLLAknpgkdleegadpaatplgf-aknarnaahfiagganslvmGAMGEHWHGEYVFSSGNLILDLLHNFFLEVA 157 Metallosphaera ...
YP_001641664  79 NGVAMLNNgpdndgdetdggdisgapfedmkdirlaaaflsngggsapiNSNGASWNNDFITSSGNVVVDLLHNFHLECG 158 Methylobacteriu...
YP_002566105  76 TAVAKNLEgasedaresaredpiidem---mrtgqprqalsaglhampvDSNGVPFTGNYVVASGNLAADLYANVMAEST 152 Halorubrum lacu...
Feature 1                                      #            
1JKV_A       151 ARLQVSRLYSMTEDEGVRDMLKFLLARETQHQLQFMKAQEELE 193 Lactobacillus plantarum
2CWL_A       158 ARTHKLRVYEMTDNPVAREMIGYLLVRGGVHAAAYGKALESLT 200 Thermus thermophilus HB8
NP_241935    153 ARTHKMRVYEMTDHPVAREMIGYLLVRGGVHIIAYAKALEIAT 195 Bacillus halodurans
BAB97198     155 ARLAKIRVYEMTDNPVAREMIGYLLVRGGVHAMAYGKALEALT 197 Pyrobaculum calidifontis
NP_845456    154 GVLQKTRIYEMSSNQTFRETLAFLIVRDNAHQNAFAKALETLG 196 Bacillus anthracis str. Ames
CAE09059     158 ARTHKLRVYEMTDNPVAREMIGYLLVRGGVHAAAYGKALESLT 200 Thermus thermophilus
NP_560191    155 ARLVKIRVYEMTDNPVAREMIGYLLVRGGVHALAYGKALEALT 197 Pyrobaculum aerophilum str. IM2
BAF81110     158 ARTHKLRVYEMTDNPVAREMIGYLLVRGGVHAAAYGKALESLT 200 Metallosphaera hakonensis
YP_001641664 159 ARLHKLRVYETLSDPTGREVCGYLLVRGSVHAHAYALALKQIT 201 Methylobacterium extorquens PA1
YP_002566105 153 GRVLATRLYEFTDDPGMKEMLEYLIARDTMHQNQWHAALEDLG 195 Halorubrum lacusprofundi ATCC 49239

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap