Conserved Protein Domain Family
Rubrerythrin_like

?
cd01046: Rubrerythrin_like 
rubrerythrin-like, diiron-binding domain
Rubrerythrin-like domain, similar to rubrerythrin, a nonheme iron binding domain found in many air-sensitive bacteria and archaea, and member of a broad superfamily of ferritin-like diiron-carboxylate proteins. Rubrerythrin is thought to reduce hydrogen peroxide as part of an oxidative stress protection system. The rubrerythrin protein has two domains, a binuclear metal center located within a four-helix bundle of the rubrerythrin domain, and a rubredoxin domain. The Rubrerythrin-like domains in this CD are singular domains (no C-terminus rubredoxin domain) and are phylogenetically distinct from rubrerythrin domains of rubrerythrin-rubredoxin proteins.
Statistics
?
PSSM-Id: 153105
View PSSM: cd01046
Aligned: 16 rows
Threshold Bit Score: 120.104
Threshold Setting Gi: 20093970
Created: 24-Sep-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
diiron binding
Feature 1:diiron binding motif [ion binding site]
Evidence:
  • Comment:The conserved residues of a diiron center are present in the Rubrerythrin_like domain.
  • Citation:PMID 8749363

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                    #                                #  #                            #  
AAB85828      13 ELENVVDANFRGECSEVGIYLAMARQAQREGLPEVAEALRRIALEEAAHAARFAELNGVIr---ENLRENLEMMLEGEEA 89  Methanothermoba...
NP_615644      2 DLEKILKDTFRGETTEVGWYLAMSKVAEQEGFADVAVYLRQIAMDEAWHATEVAEILGLVk---GTTIENLEMMLEGESK 78  Methanosarcina ...
NP_614532      3 GLEEHLERWFKNESEAVTVYRTLAGLAEEAGMSEVAETFRKIADEELRHAAIVARIAGKLs---EDIRAEVERLAEREAQ 79  Methanopyrus ka...
NP_613817      2 DFEEYLEKWFKGETTEVGIYMAMAIVAREQGYPEVCDLLEQIAMDEARHAAAAALIAGKVenslEGLIEKMEEMIEGEKN 81  Methanopyrus ka...
Q58156        18 ELEKEVQANFEGECKEVGLYLAMARQAQREGLPEVAEVLIRIAMEEAQHAAHFAEMNGLIs---ENLKENIEMMLKGECM 94  Methanocaldococ...
YP_001679063  16 VVEDAVNANFRGETQETGLYLAMARQAQRQGYPEVAEVLKRIAWEEAEHAAHFAELNGMIs---ESTKENLEKMLAGEIG 92  Heliobacterium ...
YP_001253528  20 KIKTDLEGQFRAETGEVGLYIAMARVAQRQGFPEIAEVLKVIATEEAEHAARYAELNGKVs---DCTKENLQKMLQGEIG 96  Clostridium bot...
YP_001917279  20 DLERPVKQNFQGETSETGLYLAMARQAQREGYPEIAESLKRIAMEEAEHAARFAELNGMIn---DSTEENLKEMLEGEIF 96  Natranaerobius ...
AAU83222       2 TTESELKANFKGETTEVGLYLAMSKQAEREGHHTAAMYFRQLAMDEAWHASEIAEILGMI----GDTKSNLEMMLAGETM 77  uncultured arch...
YP_001310162  11 DLEEKINEMWKAEAIGAATYQAFAIVAQEKGLPELADELKKISADEARHGGLYASLNGHTn---KNLRDALSSMSIGEIS 87  Clostridium bei...
Feature 1                                      #  #            
AAB85828      90 ANREKREAALRARECGVDEAHDFFDESSRDEGRHAAMLRGLLQRYF 135 Methanothermobacter thermautotrophicus str. Delta H
NP_615644     79 AEVEKAEAAELARKEGNTRAALFFERASLDEARHKAGLRGFLERIK 124 Methanosarcina acetivorans C2A
NP_614532     80 AAELRRNVIEEYGDEMSEDVRAYLISTAHDEERHTKMLRNLLKRLE 125 Methanopyrus kandleri AV19
NP_613817     82 AYETRMDEADHHSDELDDEIITLLKATAYDEKHHRKMLKAALEKLK 127 Methanopyrus kandleri AV19
Q58156        95 ANKEKKAAATKAKELGIDPAHDFFDESSRDEARHAKMLKGILDRYF 140 Methanocaldococcus jannaschii
YP_001679063  93 ANKGKKMAATEAKQNDIDAAHDFFDESSKDEARHAQMLKGMLDRYF 138 Heliobacterium modesticaldum Ice1
YP_001253528  97 SNKMKKSLAVKAKEENIDEVHDFIDEASRDEARHAKMLKGLLDRYF 142 Clostridium botulinum A str. ATCC 3502
YP_001917279  97 ANQDKKKAAEKAKDQELTETYTYFIESSKDEARHAKMLEGLVNKYF 142 Natranaerobius thermophilus JW/NM-WN-LF
AAU83222      78 AETEKADAAKAAEAEGNIDAARFFERASKDEARHKAGLKGILMRFD 123 uncultured archaeon GZfos27A8
YP_001310162  88 AGEKIKELSNILDKLGLKEAAQAVHTAGEDECRHGEILKELIEKYL 133 Clostridium beijerinckii NCIMB 8052

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap