1K3C,1KHG,1KO7


Conserved Protein Domain Family
PEPCK_HprK
?
cd00820: PEPCK_HprK 
Click on image for an interactive view with Cn3D
Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity. PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of HPr and its dephosphorylation by phosphorolysis. PEPCK and the C-terminal catalytic domain of HprK/P are structurally similar with conserved active site residues suggesting that these two phosphotransferases have related functions.
Links
?
Statistics
?
PSSM-Id: 238418
Aligned: 3 rows
Threshold Bit Score: 92.3585
Created: 6-Mar-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Download Cn3D
 
Conserved site includes 14 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
Scroll to Sequence Alignment Display
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection: 
Feature 1          #                     #######                 ##                        # #
1K3C_A    227 GIASMHCSANVgek----gdvAVFFGLSGTGKTTLStd------pkRRLIGDDEHGWDDd-----gVFNFEg---gCYAK 288 Escherichia coli
1KHG_A    262 GWLAEHMLVLGitnpegekkyLAAAFPSACGKTNLAmmnpslpgwkVECVGDDIAWMKFdaqghlrAINPEn---gFFGV 338 human
1KO7_A    131 RTTSLHGVLVDvyg-----vgVLITGDSGIGKSETAleli---krgHRLVADDNVEIREiskdeliGRAPKliehlLEIR 202 Staphylococcus xyl...

Feature 1                                                                                     
1K3C_A    289 tiklskeaepeiynairrdallenvtvredgti---------------------------dfddgsktentrvsypiyhi 341 Escherichia coli
1KHG_A    339 apgtsvktnpnaiktiqkntiftnvaetsdggvywegideplasgvtitswknkewssedgepcahpnsrfctpasqcpi 418 human
1KO7_A    203 glgiinvmtlf--------------------------------------------------------------------- 213 Staphylococcus xyl...

Feature 1                                                                                     
1K3C_A    342 dnivkpvskaghATKVIFLtadafgvlppvsrltadqtqyhflsgftaklagterg-iteptptfsacfgaaflslhptq 420 Escherichia coli
1KHG_A    419 idaawespegvpIEGIIFGgrrpagvplvyealswqhgvfvgaamrseataaaehkgkiimhdpfamrpffgynfgkyla 498 human
1KO7_A    214 --gagsiltekrLRLNIHLenwhkeklydrvg------------------------------------------------ 243 Staphylococcus xyl...

Feature 1                         #                #        
1K3C_A    421 yaevlvkrmqaagAQAYLVNTgwngtgk---risikdTRAIIDAIL 463 Escherichia coli
1KHG_A    499 hwlsmaqhpaaklPKIFHVNWfrkdkegkflwpgfgeNSRVLEWMF 544 human
1KO7_A    244 -lneetlrildteITKKTIPVrpg-----------rnVAVIIEVAA 277 Staphylococcus xylosus

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap