Conserved Protein Domain Family

cd00818: IleRS_core 
Click on image for an interactive view with Cn3D
catalytic core domain of isoleucyl-tRNA synthetases
Isoleucine amino-acyl tRNA synthetases (IleRS) catalytic core domain . This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. IleRS has an insertion in the core domain, which is subject to both deletions and rearrangements. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids.
PSSM-Id: 173909
Aligned: 32 rows
Threshold Bit Score: 282.584
Created: 24-Sep-2002
Updated: 2-Oct-2020
Aligned Rows:
Conserved site includes 29 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
  • Structure:1JZS_A; T. thermophilus IleRS bound to Mupirocin , defined using 4.0 A contacts.
    View structure with Cn3D
  • Structure:1FFY_A; S. aureus IleRS bound to Mupirocin and 3' end of tRNA, defined using 4.0 A contacts
    View structure with Cn3D
  • Comment:Mupirocin specifically targets bacterial and archaeal IleRSs

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1              ###     # ##  #                                                         
Feature 1                                                                                      
Feature 1                                                                                      
1FFY_A     203 krsasiyvafnvkddkgvvdadakfiiwtttpwtipsnvaitvhpelkygqynvngekyiiaealsdavaealdwdkasi 282  Staphylococcus a...
1JZS_A     198 keiqdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealileeglgrkllgegtqvlk 277  Thermus thermoph...
P48526     242 nhksiaayvkfplekksqmdlckklgitnnlpiycliwtstpwtllsnraicfnqdfsysllrlnselilvetgsidklg 321  baker's yeast
P73505     208 ghtsrsiyvsfpitqagekaaeilapyiddlavaiwtttpwtlpgnlavalnpeltyavveteshifhrsylivaldlve 287  Synechocystis sp...
P00956     205 ktspsidvafqavdqdalkakfavsnvngpislviwtttpwtlpanraisiapdfdyalvqidgqavilakdlvesvmqr 284  Escherichia coli...
O66651     210 kedpsiyvkfplksgekfgikdkkvfaiiwtttpwtlpanlgimvkedadyvlvevedevwivakelmdkffetvnrpeg 289  Aquifex aeolicus
BAA95147   244 ehvsrsiyvkfpllkpspklaslidgsspvsilvwttqpwtipaneavcympeskyavvkcsksgdlyvlaadkvasvas 323  human
BAB10327   218 ghisksiyaifklvggaktslldefipniylavwtttpwtmpanaavavnaklqysvvevqsfnqqklfvivatdlvpal 297  thale cress
NP_108385  224 yesdtiwakfpvanlvvanvvdgqpaelnpdlsdrsldlldahvviwtttpwtipgnravsysprvayglyevtaaenaf 303  Mesorhizobium lo...
NP_587938  231 nhvstsiyftfpvnsfsidgceynnvkalvwtttpwtipsnlalsyhpeinyglyqhnnsiylmsdnlvpnldfmqgakr 310  fission yeast
Feature 1                                                                                      
1FFY_A     283 klekeytgkele------------------------------------------------------wvvaqhpfldresl 308  Staphylococcus a...
1JZS_A     278 tfpgkalegl---------------------------------------------------------pytppypqalekg 300  Thermus thermoph...
P48526     322 lttnsfetikqfqgthlnglyyq-------------------------------nllvddkvgrpllhgahvtsgtgtgl 370  baker's yeast
P73505     288 klsetfgvkltvkvtlqg------------------------------------------eslentcyqhplfdrvspiv 325  Synechocystis sp...
P00956     285 igvtdytilgtvkga-----------------------------------------------elellrfthpfmgfdvpa 317  Escherichia coli...
O66651     290 lvletvkgkdlvgleythp---------------------------------------fvekeklkghlseetlknmwki 330  Aquifex aeolicus
BAA95147   324 tlettfetistlsgvd---------------------------------------------lengtcshplipdkaspll 358  human
BAB10327   298 eakwgvklsisktflgs--------------------------------------------dlencrythpidnrdcpvv 333  thale cress
NP_108385  304 gpepgeklifadalaaesqakakitlkrlhhvsaeqlgnlvlshpfkglgggyefpvpmvagdhvtddagtgfvhtapgh 383  Mesorhizobium lo...
NP_587938  311 lascpsdiissft----------------------------------------------------yenpllpkqsfpflq 338  fission yeast
Feature 1                                                                                      
1FFY_A     309 vingdhvttdagtgcvhtapghgeddyivgqqyelpvispiddkgvfteeggqfegmfydkankavtdlltekgallkld 388  Staphylococcus a...
1JZS_A     301 yfvvladyvsqedgtgivhqapafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgllfkee 380  Thermus thermoph...
P48526     371 vhtapghgqddyligiqngleiyspvdhqgryqlnelpqsvrsivrdegdltkgrqvldaetakiilcklsdlnllyksh 450  baker's yeast
P73505     326 iggdyvttesgtglvhtapghgqedyvvgqryglpilspvdaagnlteeagkfaglnvlndaneaiinalqdqkvllkee 405  Synechocystis sp...
P00956     318 ilgdhvtldagtgavhtapghgpddyvigqkygletanpvgpdgtylpgtyptldgvnvfkandivvallqekgallhve 397  Escherichia coli...
O66651     331 ypsefvsldtgtglvhmapghgqedyvvgqryglepyapvsdegrfvepapeflinvrvfdanhlivgvlkekgflvhee 410  Aquifex aeolicus
BAA95147   359 panhvtmakgtglvhtapahgmedygvasqhnlpmdclvdedgvftdvagpelqnkavleegtdvvikmlqtaknllkee 438  human
BAB10327   334 iggdyittesgtglvhtapghgqedyatglkyglplvspvddegkfteeagqfrglsvlgegntavvsyldenmslvmee 413  thale cress
NP_108385  384 gredfdawmdaapqlrargidtvipftvddagfftrdapgfgpdreggaarviddngkkgnanqavidelikrnalfarg 463  Mesorhizobium lo...
NP_587938  339 snyvtndigtgivhvapghgmedyllglennlrpfsplddygrytkealdgsleglevlgdggkkvisimknqnmivkvs 418  fission yeast
Feature 1                                                                 #                    
1FFY_A     389 fithsyphdwrtkkPVIFRATPQWFASIs-------kVRQDILDAIENTNFKVNWGKT-RIYNMVRdRGEWVISRQRVWG 460  Staphylococcus a...
1JZS_A     381 sylhsyphcwrcstPLMYYATESWFIKNt-------lFKDELIRNNQEIHWVPPHIKEgRYGEWLKnLVDWALSRNRYWG 453  Thermus thermoph...
P48526     451 eythsypydwrskkPVIIRATPQWFADLh-------dVKNLALESISRVKFCPKRGYS-RLSSFMKsRNEWCISRQRSWG 522  baker's yeast
P73505     406 ayehkypydwrtkkPTIFRATEQWFASVe-------gFRDQALKAIKEVTWIPTQGEN-RITPMVGdRSDWCISRQRAWG 477  Synechocystis sp...
P00956     398 kmqhsypccwrhktPIIFRATPQWFVSMdq-----kgLRAQSLKEIKGVQWIPDWGQA-RIESMVAnRPDWCISRQRTWG 471  Escherichia coli...
O66651     411 kirhsyphcwrcknPVIFRATPQWFIGMdief-fgktLRQRALEEIEKVKWIPEYGKN-RIKSMVEnRPDWCISRQRFWG 488  Aquifex aeolicus
NP_108385  464 rlkhsyphswrskkPVIFRNTPQWFVYMdkdlgdgttLRSRALKAIDDTRFVPAAGQN-RIRAMIEeRPDWVLSRQRAWG 542  Mesorhizobium lo...
NP_587938  419 pykhrypydwrthkPLILRATPQWFISLe-------nERKTAIKALDSVKMIPPNSRA-RLLGFLNgRPEWCISRQRAWG 490  fission yeast
Feature 1                                                                             #  #     
1FFY_A     461 VPLPVFYAE--NGEIIMtketvnhvadlfaehgsniwfe--reakdllpegfthpgspngtfTKETDIMDVWFDSGSSHR 536  Staphylococcus a...
1JZS_A     454 TPLPIWVCQa-CGKEEAigsfqelkaratkplpepfd------phrpyvdqvelacacggtmRRVPYVIDVWYDSGAMPF 526  Thermus thermoph...
P48526     523 IPILSFYKKsePDSVLMnseilahaiekikqkginawfn--dkdndmkewlpekyhdvaheyCRSQDTMDVWFDSGSSWS 600  baker's yeast
P73505     478 VPIPVFYDEe-TSEPLLteetinhvqqiiaekgsdaw-----weltveellpeayrnngrtyRKGEDTMDVWFDSGSSWA 551  Synechocystis sp...
P00956     472 VPMSLFVHKd-TEELHPrtlelmeevakrvevdgiq--------awwdldakeilgdeadqyVKVPDTLDVWFDSGSTHS 542  Escherichia coli...
O66651     489 VPITVFYCEn-CGEIIKdrevfervaqlvensekgsdvwfeltssqllpegykcpkcggdsfTKEEDILDVWFDSGCSHA 567  Aquifex aeolicus
BAA95147   511 VPIPVFHHKt-KDEYLInsqttehivklveqhgsdiwwtlppeqllpkevlsevggpdaleyVPGQDILDIWFDSGTSWS 589  human
BAB10327   486 VPIPAFYHVk-TKEPLMneetinhvksiisqkgsdaw-----wymsvedllpekyrdkaadyEKGTDTMDVWFDSGSSWA 559  thale cress
NP_108385  543 VPIAVFADE--DGNVLKdeavnqrimdafeeegada-------wfaagakerflgnhdaskwKQVMDILDVWFDSGSTHV 613  Mesorhizobium lo...
NP_587938  491 LPIPVLYEKgtKIPLLTvksvsyiiekmevegvdswfn----dtennghaqwvhpdyrnkeyIRGTETLDVWFDSGTSWT 566  fission yeast
Feature 1                              ##### # #                        #####   ######         
Feature 1                                      #   
1FFY_A     607 --------DQVVKQKGADIARLWVSSTd-yLADVRI 633  Staphylococcus aureus
1JZS_A     603 --------WDIIRKFGADALRWYIYVSappEADRRF 630  Thermus thermophilus
P48526     681 aii-rgdeNLGLPALGVDGLRYLIAQSn-fTTDIVA 714  baker's yeast
P73505     624 qiinggknQKQEPAYGADVLRLWVASVd-yANDVPI 658  Synechocystis sp. PCC 6803
P00956     614 --------QDVMNKLGADILRLWVASTd-yTGEMAV 640  Escherichia coli K-12
O66651     636 --------QEVVKEFGADILRLWVVSEd-yTEDVKL 662  Aquifex aeolicus
BAA95147   658 vvvnggqdQSKEPPYGADVLRWWVADSn-vFTEVAI 692  human
BAB10327   631 lvieggknSKDAPAYGADVMRLWVSSVd-yTGDVLI 665  thale cress
NP_108385  684 --------QDVIKQSGADILRLWVVTTd-yWEDQRL 710  Mesorhizobium loti MAFF303099
NP_587938  638 dvingkllKGKKLPYGVDLLRLWVASCd-sTNDTNL 672  fission yeast

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap