
Conserved Protein Domain Family

cd00812: LeuRS_core 
Click on image for an interactive view with Cn3D
catalytic core domain of leucyl-tRNA synthetases
Leucyl tRNA synthetase (LeuRS) catalytic core domain. This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. In Aquifex aeolicus, the gene encoding LeuRS is split in two, just before the KMSKS motif. Consequently, LeuRS is a heterodimer, which likely superimposes with the LeuRS monomer found in most other organisms. LeuRS has an insertion in the core domain, which is subject to both deletions and rearrangements and thus differs between prokaryotic LeuRS and archaeal/eukaryotic LeuRS. This editing region hydrolyzes mischarged cognate tRNAs and thus prevents the incorporation of chemically similar amino acids.
PSSM-Id: 173906
Aligned: 31 rows
Threshold Bit Score: 244.85
Created: 24-Sep-2002
Updated: 2-Oct-2020
Aligned Rows:
Conserved site includes 14 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
  • Structure:1H3N_A; Thermus thermophilus LeuRS binds leucyl-adenylate, defined using 4.0 A contacts
    View structure with Cn3D

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1             # #     #  #                           #       #                         
Feature 1                                                                                      
Feature 1                                                                                      
1WZ2_A     185 WDpvvgtplgdhdlmegedvpildyiiikfelrengeviylpaatlrpetvygvtnmwvnpnatyvkakvrrkdkeetwi 264  Pyrococcus horik...
1H3N_A     158 WCpkcqtvlaneqvve---------------------------------------------------------------- 173  Thermus thermoph...
P10857     236 WRrqfvttdanpyydafvrwqmnrllelnkikfgkrytiysikdgqpcmdhdrsegegvlpqeytalklkvtewapkaae 315  Neurospora crassa
P26637     215 WRrsfvttdanpyydafirwqmnklkaagkikfgerytiysekdgqacmdhdrqsgegvtpqeyigvkiealefaddaak 294  baker's yeast
Q10490     223 WRrsfittdvnpyydsfvrwqvnhlhdsgkikfgerytvysikdgqpcmdhdrksgegvgpqeytgikmevlefpeaark 302  fission yeast
P58176     181 YCpndgfpvgmhdtrgdiepeittmnvimfegsdsynfmvatsrpelifgvvalmvnhdanyvvveyegknfiisekayk 260  Sulfolobus solfa...
Q58050     181 YCprcdnpvedhdilvgenatlveyilikfttedgcimpmatlrpetvfgvtnvwvnpeatyvkakvyleketengieli 260  Methanocaldococc...
Q9YD97     180 WCpkeqkvvgdhdrpdeyagispqeaviikfrgrdglvypaltyrpetvfgvtnlwvhpdatylvaevdgeerwiigeqa 259  Aeropyrum pernix
Q9HK31     195 YSleddnavgeddikdgdtdkvtieeytaiffrgksfdliaaslrpetiygitniwvnpdvkyvkvkisgrmavvseecs 274  Thermoplasma aci...
O33768     176 WCpvhhipvgmhdtkgdvepeigefvliyfnsekgifpaatlrpetifgatalwinpsemyvvasmlgkkmilsekaaak 255  Sulfolobus solfa...
Feature 1                                                                                      
1WZ2_A     265 vskeaayklsfqdreievieefkgekligkyvrnpvsgdeviilpaefvdpdnatgvvm--------------------- 323  Pyrococcus horik...
1H3N_A         --------------------------------------------------------------------------------      Thermus thermoph...
P10857     316 alkgklpeganvylcpatlrpetmygqvccfvgpalkygvfkaaeneyfviteraaknmayqgifekegviekaadivgs 395  Neurospora crassa
P26637     295 iidsssdldkskkfyfvaatlrpetmygqtccfvsptieygifdagdsyfitterafknmsyqkltpkrgfykpivtvpg 374  baker's yeast
Q10490     303 alqsidlsnkkvcmiaatlrpetmygqtncyvgpnitygiyesnvpnelfictrraannmayqklskergvvselgtikg 382  fission yeast
P58176     261 klsfqknmklvktittsdivklyainpitgrkleiiknkyvdpslgtgvvms---------------------------- 312  Sulfolobus solfa...
Q58050     261 engiwimakecaeklkhqdrkieiieefkgeqlinkkvknpvtgkevpilpakfvk------------------------ 316  Methanocaldococc...
Q9YD97     260 areladqghrvvileriegrrllgrivvnpadgrevpvlpasfvrpdlgtgvvmsvp----------------------- 316  Aeropyrum pernix
Q9HK31     275 tklkfqgneievageasvqeiqkqtyttpagkevkvyqadfvd------------------------------------- 317  Thermoplasma aci...
O33768     256 lsfqiddieieekikgsklvglkvenpitgkhiavlgadfvdvslgtgvvmsv--------------------------- 308  Sulfolobus solfa...
Feature 1                                                                                      
1WZ2_A     324 ------------------------------svpahapfdhvaledlkreteilekydidprivenityisliklegygdf 373  Pyrococcus horik...
1H3N_A         --------------------------------------------------------------------------------      Thermus thermoph...
P10857     396 dli--gtlvnaplsvhkevyvlpmdtvlatkgtgvvtsvpsdspddcammtelakkpefygiqkewaekeivsviktpts 473  Neurospora crassa
P26637     375 kafigtkihapqsvypelrilpmetviatkgtgvvtcvpsnspddyittkdllhkpeyygikpewidheivpimhtekyg 454  baker's yeast
Q10490     383 qdligalvnaplsvhkqvyvlpmetvlatkgtgvvtsvpsdspddfatltelrkkaefyhlnpewmkyeavpiirtpsyg 462  fission yeast
P58176     313 -------------------------------------ypahdpfhylamtetnkefevipvveteeldeipgesavlqtk 355  Sulfolobus solfa...
Q58050     317 ---------------------------------tnigtgcvmsvpahapydyialrdlglvdeigliplinvpgygkypa 363  Methanocaldococc...
Q9YD97     317 --------------------------------ahapydyvalmelkrrpetlreyglepgvveslepiqliavpraegll 364  Aeropyrum pernix
Q9HK31     318 ---------------------------------------------pdngtgivysvpshsvydyvyyrkkrgkdfpviie 352  Thermoplasma aci...
O33768     309 -----------------------------------pahapfdyyyskktfknnnieiipvitveglgnalakdvveknnp 353  Sulfolobus solfa...
Feature 1                                                                                      
1WZ2_A     374 paveevnklgiksqkdkekleqatktiykaeyhkgifkvppyegkpvqevkeaiakemlekgiaeimyefaeknvisrfg 453  Pyrococcus horik...
1H3N_A     174 -------------------------------------------------------------------------grcwrhe 180  Thermus thermoph...
P10857     474 dllapylvkklkinspkdakqlleakelaykegfyqgimnygdfkgekvetakpkvrqqlidagdafaysepenkvvsrs 553  Neurospora crassa
P26637     455 dltakaiveekkiqspkdknllaeakkiaykedyytgtmiygpykgekveqaknkvkadmiaageafvynepesqvmsrs 534  baker's yeast
Q10490     463 dmcaeflckklkiqspkdvkqlaqakelaykecfyqgtmiigkysgekvetakpkvrkelidqglafvynepegqvisrs 542  fission yeast
P58176     356 npyalkdfmesiykteyykgymkdiilslvpdflkqyvkenivgkqvqearkntiellkslniydtiyeisngpiycrcg 435  Sulfolobus solfa...
Q58050     364 keivekmgiksqeeedkleeatkkiykdefhkgvlnencldyegipvreikdkltkdlidkglaeimyefseekvicrcg 443  Methanocaldococc...
Q9YD97     365 vveevrrrgvesqmdrekldeatrevyarefyegimlettgrfsglkvaeakekvvewleergaalriytlpqevycrcg 444  Aeropyrum pernix
Q9HK31     353 apmkmkdieskydleteegreeatkdlyrnefyygklvdsgpytgmtvreareavkrdlissgnaftfyetsrhavtrsg 432  Thermoplasma aci...
O33768     354 ksdedlkklteyvyrteynkgvlrsdlgnlireeyrnelkslgglpvpkgrelitnfliskglgrkifevmnkpvycrcg 433  Sulfolobus solfa...
Feature 1                                                                                      
1WZ2_A     454 nravikIIHDQWFIDYgnPEWKEKARKALERMki-----lPETRRAQFEAIIDwld------------------------ 504  Pyrococcus horik...
1H3N_A     181 dtpvekRELEQWYLRI--TAYAERLLKDLEGLn------wPEKVKAMQRAWIGrsegaeilfpvegkevripvfttrpdt 252  Thermus thermoph...
P10857     554 gdecsvALMDQWYIDYgeDSWRTVLYDYVENKdgkgintyYADTQHAFKGVIGwlk------------------------ 609  Neurospora crassa
P26637     535 gddcivSLEDQWYVDYgeESWKKQAIECLEGMql-----fAPEVKNAFEGVLDwlk------------------------ 585  baker's yeast
Q10490     543 gddcivALCDQWFLDYgeASWKAVTEKALDRLnt-----fSPEVRNGFLKTLDwls------------------------ 593  fission yeast
P58176     436 seivpkRIKDQWFIAYdnPKWKASALKAINNIel-----iPNPTKTELEKIVFnar------------------------ 486  Sulfolobus solfa...
Q58050     444 tpcivkMVKGQWFIKYsdEKWKELAHKCIDKMrf-----iPENLRQVFHEKIDwmk------------------------ 494  Methanocaldococc...
Q9YD97     445 arthvkIVEDQWFLLYskPEWKALAREAVARMef-----lPGHVRRDFEAIIEalr------------------------ 495  Aeropyrum pernix
Q9HK31     433 skvivaVLPDQWFLDYsqPWLKDLGHTMINTMtm-----hPEVYRNVMNDAIDwlk------------------------ 483  Thermoplasma aci...
O33768     434 teivvkILKDQWFLDYsnKEWKELARKSLSKInv-----iPEESRKDFEFTIEwle------------------------ 484  Sulfolobus solfa...
Feature 1                                                                                      
1WZ2_A         --------------------------------------------------------------------------------      Pyrococcus horik...
1H3N_A     253 lfgatflvlapehpltlelaapekreevlayveaakrkteierqaegrektgvflgayalnpatgeripiwtadyvlfgy 332  Thermus thermoph...
P10857         --------------------------------------------------------------------------------      Neurospora crassa
P26637         --------------------------------------------------------------------------------      baker's yeast
Q10490         --------------------------------------------------------------------------------      fission yeast
P58176         --------------------------------------------------------------------------------      Sulfolobus solfa...
Q58050         --------------------------------------------------------------------------------      Methanocaldococc...
Q9YD97         --------------------------------------------------------------------------------      Aeropyrum pernix
Q9HK31         --------------------------------------------------------------------------------      Thermoplasma aci...
O33768         --------------------------------------------------------------------------------      Sulfolobus solfa...
Feature 1                                                                                      
1WZ2_A         --------------------------------------------------------------------------------      Pyrococcus horik...
1H3N_A     333 gtgaimavpahdqrdyefarkfglpikkvierpgeplpeplerayeepgimvnsgpfdgteseegkrkviawleekglgk 412  Thermus thermoph...
P10857         --------------------------------------------------------------------------------      Neurospora crassa
P26637         --------------------------------------------------------------------------------      baker's yeast
Q10490         --------------------------------------------------------------------------------      fission yeast
P58176         --------------------------------------------------------------------------------      Sulfolobus solfa...
Q58050         --------------------------------------------------------------------------------      Methanocaldococc...
Q9YD97         --------------------------------------------------------------------------------      Aeropyrum pernix
Q9HK31         --------------------------------------------------------------------------------      Thermoplasma aci...
O33768         --------------------------------------------------------------------------------      Sulfolobus solfa...
Feature 1                                                                                      
1WZ2_A     505 --------kkaCARKIGLGTPLPWd------------------------------------------------------- 521  Pyrococcus horik...
1H3N_A     413 grvtyrlrdwlISRQRYWGTPIPMvhceacgvvpvpeeelpvllpdlkdvedirpkgkspleahpefyettcpkcggpak 492  Thermus thermoph...
P10857     610 --------qwaCARTYGLGSKLPWd------------------------------------------------------- 626  Neurospora crassa
P26637     586 --------nwaVCRTYGLGTRLPWd------------------------------------------------------- 602  baker's yeast
Q10490     594 --------qwaCARSYGLGTRLPWd------------------------------------------------------- 610  fission yeast
P58176     487 --------kepIGRSRGIGVKLPWd------------------------------------------------------- 503  Sulfolobus solfa...
Q58050     495 --------dkaCVRRRGLGTKFPFe------------------------------------------------------- 511  Methanocaldococc...
Q9YD97     496 --------dwaFTHKGELGTPLPWd------------------------------------------------------- 512  Aeropyrum pernix
Q9HK31     484 --------erpCARRRGLGTRLPFd------------------------------------------------------- 500  Thermoplasma aci...
O33768     485 --------kraCARTRGLGTPLPWd------------------------------------------------------- 501  Sulfolobus solfa...
Feature 1                                                                                      
1WZ2_A     522 -pEWVIESLSDSTIYMAYYTIsrhinklrqegkldpekltpeffdyifle--efsedkekelekktgipaeiihemkeef 598  Pyrococcus horik...
1H3N_A     493 rdTDTMDTFFDSSWYYLRYTDphndrlp----------------------------------------------fdpeka 526  Thermus thermoph...
P10857     627 -pNFLVESLSDSTVYMAYYTVahwlhrdlfgrekgkgnigadqmidevwdyifcrtelsdhlvtksgipketldsmrref 705  Neurospora crassa
P26637     603 -eKYLVESLSDSTIYQSFYTIahllfkdyygneigplgisadqmtdevf----dyifqhqddvkntniplpalqklrref 677  baker's yeast
Q10490     611 -pQFLVESLTDSTIYMAYYTIchllhsdvygkvpgalnikpeqmtpevw----dhvfrqapkpkntsisdealarlcref 685  fission yeast
P58176     504 -eSQIVESLSDSTLYTLLYTViykmpiniekeifdfiflgkg------------------dakelerkygtdliqlreef 564  Sulfolobus solfa...
Q58050     512 -eGWVIESLSDSTIYPAYYTVakyinqhnikpeqltlelfdyvflgk---------gdvdkiaketgipkdiiegmrkef 581  Methanocaldococc...
Q9YD97     513 -rEWVIESLSDSTIYMAYYTIakytqhpekygvepemltpevfdyvfl------gagdpgevsrrsgipqglleemrref 585  Aeropyrum pernix
Q9HK31     501 -dRWVIESLSDSTIYPAVYTNsiplrslyetgkldddaitr--------------------ifmngepknedeseakrqf 559  Thermoplasma aci...
O33768     502 -kKWIIESLSDSTIYMAYYTIshkikqyklspskltqefwdyvmlgi---------gnleeisektgipsniikefreef 571  Sulfolobus solfa...
Feature 1                 # ##   #                            #  #                             
1WZ2_A     599 eYWYPLDWRCSGKDLIPNHLTFFIFNHVAIFree-----hwPKGIAVNGFGTLeg------------------------- 648  Pyrococcus horik...
1H3N_A     527 nAWMPVDQYIGGVEHAVLHLLYSRFFTKFLHdlgmvkveepFQGLFTQGMVLAwtdfgpvevegsvvrlpeptrirleip 606  Thermus thermoph...
P10857     706 qYFYPLDIRVSGKDLIPNHLTFWLYNHIALFpre-----ywPKSVRANGHLQLng------------------------- 755  Neurospora crassa
P26637     678 eYFYPLDVSISGKDLIPNHLTFFIYTHVALFpkk-----fwPKGIRANGHLMLnn------------------------- 727  baker's yeast
Q10490     686 qYFYPFDIRASGKDLVPNHLTFCLYTHTAIFdek-----ywPKGIRANGHLLMng------------------------- 735  fission yeast
P58176     565 lYWYPVDQRHTGRDLIQNHIPFYIYNHLAIFgek-----ylPKRIVINGFVRVgg------------------------- 614  Sulfolobus solfa...
Q58050     582 iYYYPVDWRCSAKDLIPNHLTFYIFNHVAIFpee-----fwPRGIVVNGYVTIeg------------------------- 631  Methanocaldococc...
Q9YD97     586 lYWYPLDMRISGKDLIPNHLVFFIFHHTAIFpre-----lwPRAIGVNGWVLVag------------------------- 635  Aeropyrum pernix
Q9HK31     560 eYWYPVDIRLTAIPHISNHLSFYVLNHAAIFpke-----kwPAGLIISGLVVSng------------------------- 609  Thermoplasma aci...
O33768     572 lYWYPLDIRHSGKDLIPNHLTFFIFNHAAIFqen-----lwPKAIAVNGLVLYeg------------------------- 621  Sulfolobus solfa...
Feature 1                                     # #                                        
1WZ2_A     649 -----------------------------qKMSKSKGNVLNFIDAIEENGADVVRLYIMSLae----hDSDFDW 689  Pyrococcus horikoshii OT3
1H3N_A     607 esalsledvrkmgaelrphedgtlhlwkpaVMSKSKGNGVMVGPFVKEQGADIARITILFAap----pENEMVW 676  Thermus thermophilus
P10857     756 -----------------------------eKMSKSTGNFMTLDDVVKKYGADAARVALADAgdg--isDSNFVE 798  Neurospora crassa
P26637     728 -----------------------------sKMSKSTGNFMTLEQTVEKFGADAARIAFADAgdt--veDANFDE 770  baker's yeast
Q10490     736 -----------------------------eKMSKSTGNFMTLHEATKKFGADATRLALADAgdt--vdDANFEE 778  fission yeast
P58176     615 -----------------------------rKMSKSLRNIYTLSKAIKEFGVDPVRIALTSTsdl--lqDLDFNE 657  Sulfolobus solfataricus
Q58050     632 -----------------------------kKLSKSKGPVLPVLEVAEKFGADVGRFYITTCael--pqDADIKF 674  Methanocaldococcus jan...
Q9YD97     636 -----------------------------eKMSKSKGNFILLRQALDWWGADATRWAEVLAgadsgldDANFEP 680  Aeropyrum pernix
Q9HK31     610 -----------------------------aKISKSKGNVVSLLEIAKKYSADIYRLYVAVQad----iSSTMDW 650  Thermoplasma acidophilum
O33768     622 -----------------------------kKMSKSLRNIIPLRKGLKMYGVDVMRIAVSSTad----mGSDVNF 662  Sulfolobus solfataricus

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap