1EUQ,4TS1,1F7U,1IRX,1LI7,1I6M,1A8H


Conserved Protein Domain Family
class_I_aaRS_core

?
cd00802: class_I_aaRS_core 
Click on image for an interactive view with Cn3D
catalytic core domain of class I amino acyl-tRNA synthetase
Class I amino acyl-tRNA synthetase (aaRS) catalytic core domain. These enzymes are mostly monomers which aminoacylate the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding.
Statistics
?
PSSM-Id: 173901
View PSSM: cd00802
Aligned: 7 rows
Threshold Bit Score: 84.8389
Threshold Setting Gi: 8569293
Created: 24-Sep-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:Residues that are generally conserved in the active site based on multiple structure evidences (using 3.5A).
  • Structure:1I6M_A; Geobacillus stearothermophilus TrpRS bound to Tryptophanyl-5'AMP using 4.0 A contacts
    View structure with Cn3D
  • Comment:Includes ATP binding sites (HIGH and KMSKS motifs)

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                  ####                                                               
1EUQ_A     29 HTRFPPEpng-ylHIGHAKs-ICLNFGIAQdy-----kGQCNLRFDDTNPVKe--------------------------- 74  Escherichia coli
4TS1_A     32 TLYCGFDptadslHIGHLAt-ILTMRRFQQa------gHRPIALVGGATGLIgdpsgkkse------------------- 85  Bacillus stearothe...
1F7U_A    147 IEFSSPNiak-pfHAGHLRs-TIIGGFLANlyeklgweVIRMNYLGDWGKQFgllavgferygneealvkdpihhlfdvy 224 baker's yeast
1IRX_B     23 VVESGITpsg-yvHVGNFRe-LFTAYIVGHalrdkgyeVRHIHMWDDYDRFRkvprnvpqewkdylgm------------ 88  Pyrococcus horikoshii
1LI7_A     25 MYVCGITvyd-lcHIGHGRt-FVAFDVVARylrflgykLKYVRNITDIDDKIikranen--------------------- 81  Escherichia coli
1I6M_A      3 TIFSGIQpsg-viTIGNYIgaLRQFVELQHe-------YNCYFCIVDQHAITvwqd------------------------ 50  Geobacillus stearo...
1A8H_A      7 VTTPIYYvna-epHLGHAYt-TVVADFLARwhrldgyrTFFLTGTDEHGETVyraaqaa--------------------- 63  Thermus thermophilus
Feature 1                                                                                     
1EUQ_A     75 ---------------------------------------------DIEYVESIKNDVEwlgfhwsgnvryssdyfdqlha 109 Escherichia coli
4TS1_A     86 -------------------------------------rtlnaketVEAWSARIKEQLGrfldfeadgnpakiknnydwig 128 Bacillus stearothe...
1F7U_A    225 vrinkdieeegdsipleqstngkareyfkrmedgdeealkiwkrfREFSIEKYIDTYArlnikydvysgesqvskesmlk 304 baker's yeast
1IRX_B     89 ------------------------------pisevpdpwgchesyAEHFMRKFEEEVEklgievdllyaselykrgeyse 138 Pyrococcus horikoshii
1LI7_A     82 --------------------------------------gesfvamVDRMIAEMHKDFDalnilrpdmeprathhiaeiie 123 Escherichia coli
1I6M_A     51 ------------------------------------------pheLRQNIRRLAALYLavgidptqatlfiqsevpahaq 88  Geobacillus stearo...
1A8H_A     64 --------------------------------------gedpkafVDRVSGRFKRAWDllgiayddfirtteerhkkvvq 105 Thermus thermophilus
Feature 1                                                                                     
1EUQ_A    110 yaielinkglayvdeltpeqireyrgtltqpgknspyrdr------------------sveenlalfekmraggfeegka 171 Escherichia coli
4TS1_A    129 pldvitflr----------------------------------------------------------------------- 137 Bacillus stearothe...
1F7U_A    305 aidlfkekgl---------------------------------------------------------------------- 314 baker's yeast
1IRX_B    139 eirlafekrdkimeilnkyreiakqpplp-----------------------------------------enwwpamvyc 177 Pyrococcus horikoshii
1LI7_A    124 lteqliakghayvadngdvmfdvptdptyg---------------------------------------vlsrqdldqlq 164 Escherichia coli
1I6M_A     89 aawmlqc------------------------------------------------------------------------- 95  Geobacillus stearo...
1A8H_A    106 lvlkkvyeagdiyygeyeglycvscerfytekelveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdlirpeg 185 Thermus thermophilus
Feature 1                                                                                     
1EUQ_A    172 clrakidmaspfivmrdpvlyrikfaehhqtgnkwciypmYDFTHCISDALEGi-------------tHSLCTLEFQd-- 236 Escherichia coli
4TS1_A    138 ---------dvgkhfsvnymmakesvqsrietgisftefsYMMLQAYDFLRLYete---------gcrLQIGGSDQWg-- 197 Bacillus stearothe...
1F7U_A    315 --------thedkgavlidltkfnkklgkaivqksdgttlYLTRDVGAAMDRYekyh-------fdkmIYVIASQQDl-- 377 baker's yeast
1IRX_B    178 pehrreaeiiewdggwkvkykcpeghegwvdirsgnvklrWRVDWPMRWSHFGv-------------dFEPAGKDHLvag 244 Pyrococcus horikoshii
1LI7_A    165 agarvdvvddkrnpmdfvlwkmskegepswpspwgagrpgWHIECSAMNCKQLgnh----------fdIHGGGSDLMfp- 233 Escherichia coli
1I6M_A     96 -----------ivyigelermtqfkeksagkeavsaglltYPPLMAADILLYNt-------------dIVPVGEDQKq-- 149 Geobacillus stearo...
1A8H_A    186 yrnevlamlaepigdlsisrpksrvpwgiplpwdenhvtyVWFDALLNYVSALdypegeayrtfwphaWHLIGKDILkp- 264 Thermus thermophilus
Feature 1                                                 #### 
1EUQ_A    237 -nRRLYDWVLDnit-----ipvHPRQYef---sRLNley---tvMSKRK 273 Escherichia coli
4TS1_A    198 -nITAGLELIRktk-----geaRAFGLti---pLVTkad--gtkFGKTE 235 Bacillus stearothermophilus
1F7U_A    378 -hAAQFFEILKqmgf---ewakDLQHVnf---gMVQg-------MSTRK 412 baker's yeast
1IRX_B    245 ssYDTGKEIIKevy-----gkeAPLSLmy---eFVGikgq-kgkMSGSK 284 Pyrococcus horikoshii
1LI7_A    234 -hHENEIAQSTcahd----gqyVNYWMhs---gMVMvdr---ekMSKSL 271 Escherichia coli
1I6M_A    150 -hIELTRDLAErfnkrygelftIPEARipkvgaRIMslvdptkkMSKSD 197 Geobacillus stearothermophilus
1A8H_A    265 -hAVFWPTMLKaag-----ipmYRHLNvg---gFLLgpd--grkMSKTL 302 Thermus thermophilus

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap