3B6R,3JU5,1CRK


Conserved Protein Domain Family
creatine_kinase_like

?
cd00716: creatine_kinase_like 
Click on image for an interactive view with Cn3D
Phosphagen (guanidino) kinases such as creatine kinase and similar enzymes.
Eukaryotic creatine kinase-like phosphagen (guanidino) kinases are enzymes that transphosphorylate a high energy phosphoguanidino compound, like phosphocreatine (PCr) in the case of creatine kinase (CK), which is used as an energy-storage and -transport metabolite, to ADP, thereby creating ATP. The substrate binding site is located in the cleft between the N and C-terminal domains, but most of the catalytic residues are found in the larger C-terminal domain. In higher eukaryotes, CKs are found as tissue-specific (muscle, brain), as well as compartment-specific (mitochondrial, cytosolic, and flagellar) isoforms. Mitochondrial and cytoplasmic CKs are dimeric or octameric, while the flagellar isoforms are trimers with three CD domains fused as a single protein chain. CKs are either coupled to glycolysis (cytosolic form) or oxidative phosphorylation (mitochondrial form). Besides CK, one of the most studied members of this family, this model also represents other phosphagen kinases with different substrate specificities, like glycocyamine kinase (GK), lombricine kinase (LK), taurocyamine kinase (TK), and echinoderm arginine kinase (AK).
Statistics
?
PSSM-Id: 153076
View PSSM: cd00716
Aligned: 16 rows
Threshold Bit Score: 573.516
Threshold Setting Gi: 239899939
Created: 6-Mar-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 15 residues -Click on image for an interactive view with Cn3D
Feature 1:ADP binding site [chemical binding site]
Evidence:
  • Structure:3B6R: a transition-state analogue complex of human brain-type creatine kinase binds ADP-Mg++, contacts at 4A
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                         
3B6R_B         16 AEDEFPD--LSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNpghp-yimTVGCVAGDEESYEVFKDLFDPI 92   human
3JU5_A         11 AKDDFPN--FEGHKSLLSKYLTADXYAKLRDVATPSGYTLDRAIQNGVDNpd-----fHLGLLAGDEETYTVFADLFDPV 83   Apostichopus ...
1CRK_A         11 PSADYPD--LRKHNNCMAECLTPAIYAKLRDKLTPNGYSLDQCIQTGVDNpghp-fikTVGMVAGDEESYEVFAEIFDPV 87   chicken
125302        430 VKEGYPD--LSKHNNHLAHCLTYDIWKSLKDKKTPSGFTLDGCIQTGVMNpghp-himTVGMVAGDEESYDVFADIFDPV 506  Strongylocent...
BAA22872        6 ARQNFPDykSNGHKCMVGRHLTEDMYERLYELRTPNGVSIDKCIQPSVDNtg-----rIIGLVAGDPESYEVFKELFDAV 80   common brandl...
BAA33059       27 AADNFPD--LSKHNNVMSSQLTKELYEKYWDKVTPNGVTLDKCIQTGVDNpgnkfygkKTGCVFGDEHSYETFKDFFDRC 104  Neanthes dive...
NP_001027661   10 DDEEYPD--LSTHNNHMAHALTLPVFASLRSKVTPSGFTLDQAIQTGVDNpghp-fimTVGCVAGDEESYEVFADLFDPV 86   Ciona intesti...
BAE16968       10 AEENFPD--FSRQDSMVRTHLTQDMYKNLFKKLTPLGVSIDKCIQPACEYvrd---ekIIGLVAGDEHSFEVFKDLFDPV 84   Sabellastarte...
XP_001632702    7 ALANFPA--LWNHNNIMARHLTPEMYVHLCDRKTSNGFTLDQAIQPGVDNpthp-nisPCGIVAGDEESFRVFAELFDLV 83   starlet sea a...
BAE16473        6 AQQNFPI--YTTHQNKVRTHLTPEMYEKMYKRVTPNGVTVDKCIQPSVDYtg-----kIVGLVAGDEESYTTFNEIFDAV 78   Arenicola bra...
Feature 1                                             # # #                                       
3B6R_B         93 IEDRHgGYKPSDEHK-TDLNPDNLqgGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAG 171  human
3JU5_A         84 IEEYHnGFKKTDNHK-TDLDASKIl-DDVLDPAYVISSRVRTGRNIRGXALSPHVCRSERRAIEKXVSEALNSLAADLKG 161  Apostichopus ...
1CRK_A         88 IKARHnGYDPRTMKHhTDLDASKIt-HGQFDERYVLSSRVRTGRSIRGLSLPPACSRAERREVENVVVTALAGLKGDLSG 166  chicken
125302        507 IDARHgGYPKDAVHV-TNINHADLkgGDNLDPKYVLSCRVRTGRSIIGYSLPPHCTVEERAAVETITIGALDKFDGDLQG 585  Strongylocent...
BAA22872       81 INEKHgGFGPTDKHPpPDLNANALv-GGQFDPKYVKSARIRTGRSVKGFCLPPSISRAERREVERIIVDALAGLEGDLAG 159  common brandl...
BAA33059      105 IEEIH-HFKPTDVHPaTDLDHEKLv-GGVFDEKYVKSCRIRCGRSVRGVCLPPAMSRAERRLVEKVVSNALGGLKEDLAG 182  Neanthes dive...
NP_001027661   87 IEARHnGYKKTDMHK-TDIDPAHLkgGTNMDPKYVLSSRVRTGRSIRGLCLPPHCSRAERRKVEQISCEALAKLDGDLKG 165  Ciona intesti...
BAE16968       85 INEQHsGFGPSEKHPkCDLDADKLqiDGVLDENYVRSCRVRTARNLKGACLPPCISRAERRLVEKVFTEALNSLDGDLKG 164  Sabellastarte...
XP_001632702   84 IEERHnGYKQNATHV-SDTNPTKVk-HGKFDENFVLSCRVRACRSIKGFRLSPINSRKEKRGIEQIAKNALGTMQGEFEG 161  starlet sea a...
BAE16473       79 LDDHHlGFSTTDKHPpPELDASKLv-NAKMDEKYVKSCRIRTGRSIRGLCLPPAISRAERREVERTLVDALAGLKGDLSG 157  Arenicola bra...
Feature 1                            #                                    #       #               
3B6R_B        172 RYYALKSMTEAEQQQLIDDHFLFDKPvSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFT 251  human
3JU5_A        162 KYYSLXKXDEKTQQQLIDDHFLFDRPvSRHFTSGGXARDFPDGRGIWHNDKKNFLVWINEEDHTRIISXQXGGNXKEVFE 241  Apostichopus ...
1CRK_A        167 KYYSLTNMSERDQQQLIDDHFLFDKPvSPLLTCAGMARDWPDARGIWHNNDKTFLVWINEEDHTRVISMEKGGNMKRVFE 246  chicken
125302        586 KYYPLEGMSDETQTQLIDDHFLFDKPvSPLLTAARMHRDWPQGRGIWHNENKNFLVWVNEEDHIRVISMEKDGNMRAVFK 665  Strongylocent...
BAA22872      160 VYYPLKKMTPEQEKQLIADHFLFQKPtGHLMVNSGAVRDWPDARGIWHNKDKTFLIWINEEDQVRIIAMQHGGDVKAVFE 239  common brandl...
BAA33059      183 KYFPLTTMNDKDMEALIEDHFLFEKPtGALLTTSGCARDWPDGRGIWHNNGKNFLVWINEEDHIRIISMQKGGDMRAVFS 262  Neanthes dive...
NP_001027661  166 KYYPLKGMSEEHQDQLINDHFLFDKPvSPLLLASNMARDWPDARGIWHNDKKNFLVWVNEEDHLRVISMEKGGNINEVFK 245  Ciona intesti...
BAE16968      165 QYYPLQSLTKEQEQRLREDHFLFQKPdSHILVNSTACRDWPTNRGIWHNDQKTFLAWINEEDHCRIMAMQKGGDIKGVFA 244  Sabellastarte...
XP_001632702  162 RYYALSSMTPQDYHHLSLEHVLSDATkHPLIVSSGMSRDWPDGRGVWHTKDKSFLIWVNEEDHLRVISMETGGDLERTYE 241  starlet sea a...
BAE16473      158 KYYPLLKMTPEEEKQLIEDHFLFQKPtGHLMVNSNAVRDWPDGRGIWHNNNKTFLIWVNEEDHCRVISMQQGGDMQGVFA 237  Arenicola bra...
Feature 1                                                  # ###                       # # ##     
3B6R_B        252 RFCTGLTQIETLFKskd-yeFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDtaAV 330  human
3JU5_A        242 RFTRGLTEVEKHIKdktgkeFXKNDHLGFVLTCPSNLGTGVRCSVHAKLPHXAKDKRFEEICTKXRLQKRGTSGEFteSV 321  Apostichopus ...
1CRK_A        247 RFCRGLKEVERLIKerg-weFMWNERLGYVLTCPSNLGTGLRAGVHVKLPRLSKDPRFPKILENLRLQKRGTGGVDtaAV 325  chicken
125302        666 RFCEGLQKFEQMIKkdg-keFMWNKHLGYVLTCPSNLGTGLRAGVHVKLPLLSKYPRFDQILRALRLQKRGTGGVDtaST 744  Strongylocent...
BAA22872      240 RFSRGLTQIEGLMKkhg-heFAWSERLGYICTCPSNLGTGLRASVHLQLHKLSKHPKFEEIILAFHLQKRGTGGEHteAV 318  common brandl...
BAA33059      263 RFGRGLTEVERLMKekg-yeLMRNERLGYICTCPTNLGTVVRASVHLRLANLEKDKRFDDFLAKLRLGKRGTGGESslAE 341  Neanthes dive...
NP_001027661  246 RWCTGLQLVEKYMKesg-yeYMWNPHLGYVLTCPSNLGTGVRAGVHLQIPLMAKCPQFDEVLGKLRLQKRGTGGVDtaSE 324  Ciona intesti...
BAE16968      245 RFARGLKEVEKKMQang-hgFQWSERLGYLSACPSNIGTGLRSSVHVQLKHLGKHPKFKEICTAMQLDKRGTGGENsaTV 323  Sabellastarte...
XP_001632702  242 RFYRGLKELESRIQkfg-heFMRNRHLGYINTCPSNLGTGLRASVHVKLPCLGKDPRFDAILCSLRLQKRGTDGDNtpIR 320  starlet sea a...
BAE16473      238 RFCTGLKEIEGLMKakg-rqFMWSERLGYLCTCPTNIGTGLRCSVHVQLHKLSKDARFDDIVVKLKMQKRGTAGEHtaAV 316  Arenicola bra...
Feature 1             #                                      
3B6R_B        331 GGVFDVSNADRLGfsEVELVQMVVDGVKLLIEMEQRLEQGQAI 373  human
3JU5_A        322 GGVYDISNLDRLGssEVEQVNCVIKGVKVLIEXEKKLEKGESI 364  Apostichopus japonicus
1CRK_A        326 ADVYDISNLDRMGrsEVELVQIVIDGVNYLVDCEKKLEKGQDI 368  chicken
125302        745 DGTFDISNLDRLGssEVQQVQFVVDGVELLVQMEKKLEKGEDI 787  Strongylocentrotus purpuratus
BAA22872      319 DDVYDISNRARLKksEREFVQLLIDGVGKLIEYEKLLEAGKSI 361  common brandling worm
BAA33059      342 DSTYDISNLARLGksERELVQVLVDGVNVLIEADKRLEAGKPI 384  Neanthes diversicolor
NP_001027661  325 GGTFDISNADRIGfsEVELVQMVIDGVEFLIECEKKLEKGESL 367  Ciona intestinalis
BAE16968      324 DDTYDISNAARLRktEREFVQHLIDGVKKLIEMDKTLEKGGKV 366  Sabellastarte indica
XP_001632702  321 EDIYDISNADRLGytEVQLVQKVIDGVNLLIKMEKRLERNQSI 363  starlet sea anemone
BAE16473      317 DDVYDLSNAARLKstEREFVQLLIDGVGKLIEMEKRLEAGKSI 359  Arenicola brasiliensis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap