1C8I,1B82,1YYD


Conserved Protein Domain Family
ligninase

?
cd00692: ligninase 
Click on image for an interactive view with Cn3D
Ligninase and other manganese-dependent fungal peroxidases.
Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.
Statistics
?
PSSM-Id: 173826
View PSSM: cd00692
Aligned: 14 rows
Threshold Bit Score: 408.323
Threshold Setting Gi: 111060227
Created: 6-Mar-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 24 residues -Click on image for an interactive view with Cn3D
Feature 1:heme binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                            ## ##  #                                 
1C8I_A     10 VTCPGG-QSTSNSQCCVWFDVLDDLQTNFYqGSKCESPVRKILRIVFHDAIGFSpaltaaGQFGGGGADGSIIAHSNIEL 88  'Arthromyces ramosus'
1B82_A      8 ATCSNG-KTVGDASCCAWFDVLDDIQQNLFhGGQCGAEAHESIRLVFHDSIAISpameaqGKFGGGGADGSIMIFDDIET 86  Phanerochaete chry...
1YYD_A      1 AVCPDG-TRVSHAACCAFIPLAQDLQETIF-QNECGEDAHEVIRLTFHDAIAISrs---qGPKAGGGADGSMLLFPTVEP 75  Phanerochaete chry...
126290     25 ATCPDG-TQLMNAECCALLAVRDDLQNNMF-NNECGDEAHEALRLTFHDAIAISpameatGQFGGGGADGSIMIFSDIET 102 Phlebia radiata
495283     27 VACPDGkNTATNAACCSLFAVRDDIQQNLFhGAQCGENAHESLRITFHDAISFSpamearGQFGGGGADGSIAIFPDIET 106 Trametes versicolor
2266938    27 ATCSGG-QTTANDACCVWFDVLDDIQSNLFhGGECGENAHESLRLIFHDAIAFSpaltaaGQFGGGGADGSIMAHTDVEI 105 Trametes versicolor
4512252    27 ATCADG-RTTANAACCVLFPILDDIQEALFdGAECGEEVHESLRLTFHDAIGFS------PTKGGGGADGSIVTFDEIET 99  oyster mushroom
CAG27835   27 AQCADG-TTVSNEACCVLLPIIADIQPNLF-ENECGEEVHETLRASFHDAIGFS------RAAGGGGADGSLVTFGDVET 98  common mushroom
AAZ14938   27 ATCPGG-QTVDDAQCCVWFDVLDDLQTNLFnGAKCENGVHKALRLQFHDSIGFSpaltasGQFGGGGSDGSIIEHDNIEL 105 Coprinellus dissem...
BAE46585   24 VSCGGG-RSVKNAACCAWFPVLDDIQANLFnGGKCEEEAHEAVRLTFHDAVGFSlaaqkaGKFGGGGADGSILAFSDIET 102 Trametes cervina
Feature 1                                                                        ###      #   
1C8I_A     89 AFPANgGLTDTIEALRAVGINHg-VSFGDL-IQFATAVGMSNCPGSPRLEFLTGRSNSSQPSPPSLIPGPGNTVTAILDR 166 'Arthromyces ramosus'
1B82_A     87 AFHPNiGLDEIVKLQKPFVQKHg-VTPGDF-IAFAGAVALSNCPGAPQMNFFTGRAPATQPAPDGLVPEPFHTVDQIINR 164 Phanerochaete chry...
1YYD_A     76 NFSANnGIDDSVNNLIPFMQKHntISAADL-VQFAGAVALSNCPGAPRLEFLAGRPNKTIAAVDGLIPEPQDSVTKILQR 154 Phanerochaete chry...
126290    103 KFHPNiGLDEVVESFRPFQQRSg-MGVADF-IQFSGAVGTSNCPGAPTLNAFIGRKDATQAAPDGLVPEPFHDVNTILAR 180 Phlebia radiata
495283    107 NFHANiGLDEIVAEQAPIQARHn-LSHADF-IMFAGALGTSNCPGAPRLDFFLGRKDATRPAPDGLVPEPFDTLEDVFAR 184 Trametes versicolor
2266938   106 QYAANnGLDEIIEEQRPFALKHn-VSFGDF-IQFAGAVGVANCNGGPQIGFFAGRSNDSQPAPDKLVPLPSDSVTDILAR 183 Trametes versicolor
4512252   100 AFHANgGIDDIVDAQKPFIARHn-ISAGDFsIQFAGAVGVSNCPGAPRLNFLLGRPPATAASPNGLIPEPFDTVTDILAR 178 oyster mushroom
CAG27835   99 TFAANaGIDEIVETLRPFINSHn-ISAGDF-IQFATVVGLTNCPGAPRIPFFLGRPDATAASPDGLVPEPFDSVTKILER 176 common mushroom
AAZ14938  106 TFPPN-GNLGGIPHLHRKPRSQ--LNRLRR-IQFAAAAGVANCPGAPRLEFLAGRPFTSQPSPPGLVPGPGNTVTRILDR 181 Coprinellus dissem...
BAE46585  103 AFIPNfGLEFTTEGFIPFALAHg-VSFGDF-VQFAGAVGAANCAGGPRLQFLAGRSNISQPSPDGLVPDPTDSADKILAR 180 Trametes cervina
Feature 1                     ## ## #######        #                                          
1C8I_A    167 MGDAG---FSPDEVVDLLAAHSLASQEGLNSAIFRSPLDSTPQVFDTQFYIETLLKGTTqpgpslgf-------aeelsp 236 'Arthromyces ramosus'
1B82_A    165 VNDAGe--FDELELVWMLSAHSVAAVNDVDPTVQGLPFDSTPGIFDSQFFVETQLRGTAfpgsggnq-------gevesp 235 Phanerochaete chry...
1YYD_A    155 FEDAGg--FTPFEVVSLLASHSVARADKVDQTIDAAPFDSTPFTFDTQVFLEVLLKGVGfpgsanntgevasplplgsgs 232 Phanerochaete chry...
126290    181 FNDAGd--FDELETVWFLIAHSVAAQNDIDPAVSHAPFDSTPSVMDGQFFIETQLRGVEfigsggie-------gvaesp 251 Phlebia radiata
495283    185 LADASageFDEILTVWLLTAHTIAATDHLDPTIPGTPMDSTPHIWDTQFFIETQLRGTAfpgtggnh-------gevmsp 257 Trametes versicolor
2266938   184 VADAG---FAPVELVWMLISHTVAAQDKVDDSIPGTPFDSTPSDFDAQFFVESMLNGTLtpgsalhd-------gevqsp 253 Trametes versicolor
4512252   179 MGDAG---FSPEEVVALLASHSVAAADHVDETIPGTPFDSTPGEFDSQFFIETQLRGTAfpgvggnq-------gevesp 248 oyster mushroom
CAG27835  177 FDDAG---FTPTEVVALLASHTVAASDTIEPGLEGVPFDSTPGEFDRQFFIETMLKGTSfpgtggnq-------gealsp 246 common mushroom
AAZ14938  182 MADAG---FSADETVDLLASHSIAAQQGLNAAIAGSPFDSTPDRFDTQFFIETLLKGVLnpgpttgf-------aevlsp 251 Coprinellus dissem...
BAE46585  181 MADIG---FSPTEVVHLLASHSIAAQYEVDTDVAGSPFDSTPSVFDTQFFVESLLHGTQftgsgqgg--------evmsp 249 Trametes cervina
Feature 1           # #                               #                                       
1C8I_A    237 fpGEFRMRSDALLARDSRTACRWQSMTSSNEVMGQRYRAAMAKMSVLGFDRnaLTDCSDVIPsavsn---naapvIPGGL 313 'Arthromyces ramosus'
1B82_A    236 lpGEIRIQSDHTIARDSRTACEWQSFVNNQSKLVDDFQFIFLALTQLGQDPnaMTDCSDVIPqskpipgnlpfsfFPAGK 315 Phanerochaete chry...
1YYD_A    233 dtGEMRLQSDFALAHDPRTACIWQGFVNEQAFMAASFRAAMSKLAVLGHNRnsLIDCSDVVPvpkpat--gqpamFPAST 310 Phanerochaete chry...
126290    252 vkGEFRLMSDQQIARDNRTACEWQSFGTDQAKLQNRFQFIFEAMGQLGTDPttLIDCSDVLPvpppl---stvphFPAGI 328 Phlebia radiata
495283    258 lkGEIRLQTDHLLARDSRTSCEWQSFVNNQQKAQDMFAFVFHDLSMLGQDPdsLIDCSELIPqpapv---igkahFPAGL 334 Trametes versicolor
2266938   254 lpGEFRLQSDFLIGRDSRTSCEWQKMIADRANMLQKFEQTVLKLLGFSQSA--LTDCSDVIPiatgt---vadpfLPAGK 328 Trametes versicolor
4512252   249 laGEIRIQSDHDLARDSRTACEWQSFVNNQAKLQSAFKAAMDKLATLGQDRskLIDCSDVIPvpkpl---qskahFPAGL 325 oyster mushroom
CAG27835  247 lpGELRLESDGLLARDERTACDWQLFATDQQKMASAFSDAMVKLSLVGQDKsqLIDCSDVIPrtipl---tnepyFPADL 323 common mushroom
AAZ14938  252 lpGEFRMQSDFAIARDPRTSCRWQELANNPQLMRTAFRTAMAKLSALGNDRssLVDCSSVIPnpaad---dtdptLPGGK 328 Coprinellus dissem...
BAE46585  250 ipGEFRLQSDFALSRDPRTACEWQALVNNQQAMVNNFEAVMSRLAVIGQIPseLVDCSDVIPtpplak-vaqvgsLPPGK 328 Trametes cervina
Feature 1                               
1C8I_A    314 TvdDIEVSCPse-pFPEIATASGPLP 338 'Arthromyces ramosus'
1B82_A    316 TikDVEQACAet-pFPTLTTLPGPET 340 Phanerochaete chrysosporium
1YYD_A    311 GpqDLELSCPse-rFPTLTTQPGASQ 335 Phanerochaete chrysosporium
126290    329 TinDVEPACAet-pFPTLPTDPGPAT 353 Phlebia radiata
495283    335 TnkDIEQACAdt-pFPTLPTDPGPKT 359 Trametes versicolor
2266938   329 TmaDIEAACAat-pFPTLSAASGPET 353 Trametes versicolor
4512252   326 TmnNIEQAPAlt-aDPGPVTTVPPVP 350 oyster mushroom
CAG27835  324 TkdDLEQTCPd--eFPDYPSNPSVTS 347 common mushroom
AAZ14938  329 VadDIEGSCAat-pFPVLPIAPGPTP 353 Coprinellus disseminatus
BAE46585  329 SmaDVQVACTngmpFPSLPTSPGPVQ 354 Trametes cervina

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap