1JFG,1JFA,1KIZ


Conserved Protein Domain Family
Terpene_cyclase_cis_trans_C1

?
cd00686: Terpene_cyclase_cis_trans_C1 
Click on image for an interactive view with Cn3D
Cis, Trans, Terpene Cyclases, Class 1
This CD includes the terpenoid cyclase, trichodiene synthase, which catalyzes the cyclization of farnesyl diphosphate (FPP) to trichodiene using a cis-trans pathway, and is the first committed step in the biosynthesis of trichothecene toxins and antibiotics. As with other enzymes with the 'terpenoid synthase fold', this enzyme has two conserved metal binding motifs that coordinate Mg2+ ion-bridged binding of the diphosphate moiety of FPP. Metal-triggered substrate ionization initiates catalysis, and the alpha-barrel active site serves as a template to channel and stabilize the conformations of reactive carbocation intermediates through a complex cyclization cascade. These enzymes function as homodimers and are found in several genera of fungi.
Statistics
?
PSSM-Id: 173834
View PSSM: cd00686
Aligned: 4 rows
Threshold Bit Score: 806.212
Threshold Setting Gi: 20150819
Created: 6-Mar-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 18 residues -Click on image for an interactive view with Cn3D
Feature 1:substrate binding pocket [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                     
1JFG_B      1 MENFPTEYFLNTTVRLLEYIRYRDSNYTREERIENLHYAYNKAAHHFAQPRQQQLLKVDPKRLQASLQTIVGMVVYSWAK 80  Fusarium sporotric...
1JFA_B      1 MENFPTEYFLNTTVRLLEYIRYRDSNYTREERIENLHYAYNKAAHHFAQPRQQQLLKVDPKRLQASLQTIVGMVVYSWAK 80  Fusarium sporotric...
1KIZ_B      1 MENFPTEYFLNTTVRLLEYIRYRDSNYTREERIENLHYAYNKAAHHFAQPRQQQLLKVDPKRLQASLQTIVGMVVYSWAK 80  Fusarium sporotric...
AAC49957    1 MDEFPTEYFLGTAVRLLENVKYRDSNYTREERIENLSYANNKAAAHFAQERQQRILKVNPKRLEASLRTIVGMVVYSWVK 80  Myrothecium roridum
Feature 1                     #  ##                                                           
1JFG_B     81 VSKECMADLSIHYTYTLVLDDSKDDPYPTMVNYFDDLQAGREQAHPWWALVNEHFPNVLRHFGPFCSLNLIRSTLDFFEG 160 Fusarium sporotric...
1JFA_B     81 VSKECMADLSIHYTYTLVLDDSKDDPYPTMVNYFDDLQAGREQAHPWWALVNEHFPNVLRHFGPFCSLNLIRSTLDFFEG 160 Fusarium sporotric...
1KIZ_B     81 VSKECMADLSIHYTYTLVLEDSKDDPYPTMVNYFDDLQAGREQAHPWWALVNEHFPNVLRHFGPFCSLNLIRSTLDFFEG 160 Fusarium sporotric...
AAC49957   81 VSKELMADLSIHYTYTLILDDSEDDPHNNMLTFFDDLQAGREQKHPWWMLVNEHFPNVLRHFGPFCSLNLIRSTLDFFEG 160 Myrothecium roridum
Feature 1        #                 #  ##                                  #   ##  #  ##    ## 
1JFG_B    161 CWIEQYNFGGFPGSHDYPQFLRRMNGLGHCVGASLWPKEQFNERSLFLEITSAIAQMENWMVWVNDLMSFYKEFDDERDQ 240 Fusarium sporotric...
1JFA_B    161 CWIEQYNFGGFPGSHDYPQFLRRMNGLGHCVGASLWPKEQFNERSLFLEITSAIAQMENWMVWVNDLMSFYKEFDDERDQ 240 Fusarium sporotric...
1KIZ_B    161 CWIEQYNFGGFPGSHDYPQFLRRMNGLGHCVGASLWPKEQFNERSLFLEITSAIAQMENWMVWVNDLMSFYKEFDDERDQ 240 Fusarium sporotric...
AAC49957  161 CWIEQYNFHGFPGSYDFPGFLRRMNGLGHCVGGSLWPKELFDEQKHFLEITSAVAQMENWMVWVNDLMSFYKEFDDPRDQ 240 Myrothecium roridum
Feature 1                                                           #        ##               
1JFG_B    241 ISLVKNYVVSDEISLHEALEKLTQDTLHSSKQMVAVFSDKDPQVMDTIECFMHGYVTWHLCDRRYRLSEIYEKVKEEKTE 320 Fusarium sporotric...
1JFA_B    241 ISLVKNYVVSDEISLHEALEKLTQDTLHSSKQMVAVFSDKDPQVMDTIECFMHGYVTWHLCDRRYRLSEIYEKVKEEKTE 320 Fusarium sporotric...
1KIZ_B    241 ISLVKNYVVSDEISLHEALEKLTQDTLHSSKQMVAVFSDKDPQVMDTIECFMHGYVTWHLCDRRYRLSEIYEKVKEEKTE 320 Fusarium sporotric...
AAC49957  241 TSLVKNYVVCDEISLTQALEKLTVDTLTSSEQMMEVFSDKDAKLMETIECFMHGYITWHLCDHRYRLKEVYEGTMHIETE 320 Myrothecium roridum
Feature 1                                          
1JFG_B    321 DAQKFCKFYEQAANVGAVSPSEWAYPPVAQLANVRSK 357 Fusarium sporotrichioides
1JFA_B    321 DAQKFCKFYEQAANVGAVSPSEWAYPPVAQLANVRSK 357 Fusarium sporotrichioides
1KIZ_B    321 DAQKFCKFYEQAANVGAVSPSEWAYPPVAQLANVRSK 357 Fusarium sporotrichioides
AAC49957  321 DAIKFRKFYGQAAKVGAIEHEEWAFPTVAERIEVRLA 357 Myrothecium roridum

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap