5EAT,1N1B,1N1Z,1N24


Conserved Protein Domain Family
Terpene_cyclase_plant_C1

?
cd00684: Terpene_cyclase_plant_C1 
Click on image for an interactive view with Cn3D
Plant Terpene Cyclases, Class 1
This CD includes a diverse group of monomeric plant terpene cyclases (Tspa-Tspf) that convert the acyclic isoprenoid diphosphates, geranyl diphosphate (GPP), farnesyl diphosphate (FPP), or geranylgeranyl diphosphate (GGPP) into cyclic monoterpenes, diterpenes, or sesquiterpenes, respectively; a few form acyclic species. Terpnoid cyclases are soluble enzymes localized to the cytosol (sesquiterpene synthases) or plastids (mono- and diterpene synthases). All monoterpene and diterpene synthases have restrict substrate specificity, however, some sesquiterpene synthases can accept both FPP and GPP. The catalytic site consists of a large central cavity formed by mostly antiparallel alpha helices with two aspartate-rich regions located on opposite walls. These residues mediate binding of prenyl diphosphates, via bridging Mg2+ ions (K+ preferred by gymnosperm cyclases), inducing conformational changes such that an N-terminal region forms a cap over the catalytic core. Loss of diphosphate from the enzyme-bound substrate (GPP, FPP, or GGPP) results in an allylic carbocation that electrophilically attacks a double bond further down the terpene chain to effect the first ring closure. Unlike monoterpene, sesquiterene, and macrocyclic diterpenes synthases, which undergo substrate ionization by diphosphate ester scission, Tpsc-like diterpene synthases catalyze cyclization reactions by an initial protonation step producing a copalyl diphosphate intermediate. These enzymes lack the aspartate-rich sequences mentioned above. Most diterpene synthases have an N-terminal, internal element (approx 210 aa) whose function is unknown.
Statistics
?
PSSM-Id: 173832
View PSSM: cd00684
Aligned: 71 rows
Threshold Bit Score: 419.678
Threshold Setting Gi: 7489781
Created: 6-Mar-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 18 residues -Click on image for an interactive view with Cn3D
Feature 1:substrate binding pocket [chemical binding site]
Evidence:
  • Structure:5EAT; Nicotiana tabacum Terpene cyclase, 5-epi-aristolochene synthase, with Mg2+ and substrate analog Farnesyl hydroxyphosphonate.
    View structure with Cn3D
  • Structure:1N24; Salvia officinalis Terpene cyclase, (+)-Bornyl diphosphate synthase with Mg2+ and product.
    View structure with Cn3D
  • Citation:PMID 9295271

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                     
5EAT       15 RPVADFSPSLWgd-----qFLSFSIDnqvae------------kyaqEIEALKEQTRSMLLat----------------- 60  common tobacco
AAB05407   84 LVKREFPPGFWkd----dlIDSLTSShkvaas---------dekrieTLISEIKNMFRCMGygetnpsaydtawvaripa 150 Abies grandis
AAC05727   11 RRTGNHHGNVWdd----dlIHSLNSPygapay----------yellqKLIQEIKHLLLTEMemd---------------- 60  white fir
AAC05728   20 SITSNRHGNMWed----drIQSLNSPygapay----------qerseKLIEEIKLLFLSDMddsc--------------- 70  white fir
T02959     49 QPDNVSSAKVFqt----srVETESKLrngrkpqdledehqaeeaelqPLIDQVRAMLRSMNdgdtsasaydtawvamvpk 124 Zea mays
BAB12440   59 LQKNGLPFINWqn----dvVEDELDKekkily---------pndeikGFVERIKVMLGSMDegeitvsaydtawvalvqd 125 garden lettuce
AAK83562   24 RRTANPHPNVWgy----dlVHSLKSPyidssy----------reraeVLVSEIKVMLNPAItgdgesmitpsaydtawva 89  white fir
NP_192187 257 IPTTLLHSLEGmrdldwekLLKLQSQdgsflfsps---stafafmqtRDSNCLEYLRNAVKrfnggv------------- 320 thale cress
AAL09965   79 RLNADYHPAVWkd----dfIDSLTSPnshatskssv--detinkriqTLVKEIQCMFQSMGdgetnpsaydtawvarips 152 maidenhair tree
Q9FT37     84 RLSANYHGDLWhh----nvIQTLETPfresst---------yqeradELVVKIKDMFNALGdgdispsaydtawvarvat 150 Chinese yew
Feature 1                                                                                     
5EAT          --------------------------------------------------------------------------------     common tobacco
AAB05407  151 vdgsdnphfpetvewilqnqlkdgswgegfyflaydrilatlaciitltlwrtgetqvqkgieffrtqagkmedeadshr 230 Abies grandis
AAC05727      --------------------------------------------------------------------------------     white fir
AAC05728      --------------------------------------------------------------------------------     white fir
T02959    125 vggdggaqpqfpatvrwivdhqlpdgswgdsalfsaydrmintlacvvaltkwsleparceaglsflhenmwrlaeeeae 204 Zea mays
BAB12440  126 idgngrpefpsslewivknqlsdgswgdhlifsahdriintlacvialtswnvhpgkcqkglkflndniskleeenpehm 205 garden lettuce
AAK83562   90 rvpaidgsarpqfpqtvdwilknqlkdgswgiqshfllsdrllatlscvlvllkwnvgdlqveqgiefiksnlelvkdet 169 white fir
NP_192187     --------------------------------------------------------------------------------     thale cress
AAL09965  153 idgsgapqfpqtlqwilnnqlpdgswgeeciflaydrvlntlaclltlkiwnkgdiqvqkgvefvrkhmeemkdeadnhr 232 maidenhair tree
Q9FT37    151 issdgsekprfpqalnwvfnnqlqdgswgieshfslcdrllnttnsvialsvwktghsqveqgtefiaenlrllneedel 230 Chinese yew
Feature 1                                                                                     
5EAT          --------------------------------------------------------------------------------     common tobacco
AAB05407  231 psgfeivfpam-----lkeakilgldlpydlpflkqiiekreaklkriptdvlyalpttllysleglqeivdwqkimklq 305 Abies grandis
AAC05727      --------------------------------------------------------------------------------     white fir
AAC05728      --------------------------------------------------------------------------------     white fir
T02959    205 smpigfeiafps---liqtardlgvvdfpyghpalqsiyanrevklkriprdmmhrvptsilhslegmpdldwprllnlq 281 Zea mays
BAB12440  206 pigfevafps------lidiarkldiqvpedspalkeiyarrnlkltkipkslmhkvpttllhslegmpdlewekllklq 279 garden lettuce
AAK83562  170 dqdslvtdfeiifpsllreaqslrlglpydlpyihllqtkrqerlaklsreeiyavpspllyslegiqdivewerimevq 249 white fir
NP_192187     --------------------------------------------------------------------------------     thale cress
AAL09965  233 psgfevvfpam-----ldeakslgldlpyhlpfisqihqkrqkklqkiplnvlhnhqtallysleglqdvvdwqeitnlq 307 maidenhair tree
Q9FT37    231 spdfeiifpa------llqkakalginlpydlpfikylsttrearltdvsaaadnipanmlnalegleevmdwkkimrfq 304 Chinese yew
Feature 1                                                                                     
5EAT       61 --------------------------------------------gRKLADTLNLIDIIERLGISYHF-EKEIDEILDQIY 95  common tobacco
AAB05407  306 skdgsflsspastaavfmrtgnkkcldflnfvlkkfgnhvpchypLDLFERLWAVDTVERLGIDRHF-KEEIKEALDYVY 384 Abies grandis
AAC05727   61 ------------------------------------------dgdHDLIKRLQIVDTLECLGIDRHFeHEIQTAALDYVY 98  white fir
AAC05728   71 -----------------------------------------ndsdRDLIKRLEIVDTVECLGIDRHF-QPEIKLALDYVY 108 white fir
T02959    282 scdgsflfspsatayalmqtgdkkcfeyidrivkkfnggvpnvypVDLFEHIWVVDRLERLGISRYF-QREIEQCMDYVN 360 Zea mays
BAB12440  280 ckdgsflfspsstafalmqtkdqkclqyltdavtkfnggvpnvypVDLFEHIWVVDRLQRLGISRYF-DSEIKDCVDYIY 358 garden lettuce
AAK83562  250 sqdgsflsspastacvfmhtgdakcleflnsvmikfgnfvpclypVDLLERLLIVDNIVRLGIYRHF-EKEIKEALDYVY 328 white fir
NP_192187 321 ----------------------------------------pnvfpVDLFEHIWIVDRLQRLGISRYF-EEEIKECLDYVH 359 thale cress
AAL09965  308 srdgsflsspastacvfmhtqnkrclhflnfvlskfgdyvpchypLDLFERLWAVDTVERLGIDRYF-KKEIKESLDYVY 386 maidenhair tree
Q9FT37    305 skdgsflsspastacvlmntgdekcftflnnllvkfggcvpcmysIDLLERLSLVDNIEHLGIGRHF-KQEIKVALDYVY 383 Chinese yew
Feature 1                                                                                     
5EAT       96 NQnsn-----------cnDLCTSALQFRLLRQHGFNISPEiFSKFQDEnGKFkesl----------asdvLGLLNLYEAS 154 common tobacco
AAB05407  385 SHwdergigw-arenpvpDIDDTAMGLRILRLHGYNVSSDvLKTFRDEnGEFfcflgq-------tqrgvTDMLNVNRCS 456 Abies grandis
AAC05727   99 RWwnekgigegsrdsfskDLNATALGFRALRLHRYNVSSGvLKNFKDEnGKFfcnftgee---grgdkqvRSMLSLLRAS 175 white fir
AAC05728  109 RCwnergigegsrdslkkDLNATALGFRALRLHRYNVSSGvLENFRDDnGQFfcgstveeegaeaynkhvRCMLSLSRAS 188 white fir
T02959    361 RHwtedgicw-arksnvkDVDDTAMAFRLLRLHGYNVSPSvFKNFEKD-GEFfcfvgq-------stqavTGMYNLNRAS 431 Zea mays
BAB12440  359 RYwtkdgicw-aknsnvqDIDDTAMGFRVLRMHGYKVTTDvFRQFEKD-GKFvcfpgq-------ttqavTGMFNLFRAS 429 garden lettuce
AAK83562  329 RHwnergigw-grlnpiaDLETTALGFRLLRLHRYNVSPAiFDNFKDAnGKFicstgq-------fnkdvASMLNLYRAS 400 white fir
NP_192187 360 RYwtdngicw-arcshvqDIDDTAMAFRLLRQHGYQVSADvFKNFEKE-GEFfcfvgq-------snqavTGMFNLYRAS 430 thale cress
AAL09965  387 RYwdaergvgwarcnpipDVDDTAMGLRILRLHGYNVSSDvLENFRDEkGDFfcfagq-------tqigvTDNLNLYRCS 459 maidenhair tree
Q9FT37    384 RHwsergigw-grdslvpDLNTTALGLRTLRTHGYDVSSDvLNNFKDEnGRFfssagq-------thvelRSVVILFRAS 455 Chinese yew
Feature 1                                                                                     
5EAT      155 HVRTHaDDILEDALAFSTIHLESAaph--------lkSPLREQVTHALEQCLHKGVPRVETRFFISs------iYDKEQs 220 common tobacco
AAB05407  457 HVSFPgETIMEEAKLCTERYLRNAlenvdafdkwafkKNIRGEVEYALKYPWHKSMPRLEARSYIEn-------YGPDDv 529 Abies grandis
AAC05727  176 EISFPgEKVMEEAKAFTREYLNQVlaghgd--vtdvdQSLLREVKYALEFPWHCSVPRWEARSFLEi-------YGHNHs 246 white fir
AAC05728  189 NILFPgEKVMEEAKAFTTNYLKKVlagre---athvdESLLGEVKYALEFPWHCSVQRWEARSFIEi-------FGQIDs 258 white fir
T02959    432 QISFQgEDVLHRARVFSYEFLRQReeqgmirdkwivaKDLPGEVQYTLDFPWYASLPRVEARTYLDq-------YGGKDd 504 Zea mays
BAB12440  430 QVLFPdEKILEDAKKFSYNYLKEKqstnelldkwiiaKDLPGEVEYALDVPWYASLPRLETRFYLEq-------YGGEDd 502 garden lettuce
AAK83562  401 QLAFPgENILDEAKSFATKYLREAleksetssawnnkQNLSQEIKYALKTSWHASVPRVEAKRYCQv-------YRPDYa 473 white fir
NP_192187 431 QLAFPrEEILKNAKEFSYNYLLEKrereelidkwiimKDLPGEIGFALEIPWYASLPRVETRFYIDqyggendvWIGKTl 510 thale cress
AAL09965  460 QVCFPgEKIMEEAKTFTTNHLQNAlaknnafdkwavkKDLPGEVEYAIKYPWHRSMPRLEARSYIEq-------FGSNDv 532 maidenhair tree
Q9FT37    456 DLAFPdEGAMDDARKFAEPYLRDAlatk-----istnTKLFKEIEYVVEYPWHMSIPRSEARSYIDs-------YDDDYv 523 Chinese yew
Feature 1                                                             #        #              
5EAT      221 -------------kNNVLLRFAKLDFNLLQMLHKQELAQVSRWWKDLDFvttlpyaRDRVVECYFWALGVYFEpqYSQAR 287 common tobacco
AAB05407  530 wlgktv-ymmpyisNEKYLELAKLDFNKVQSIHQTELQDLRRWWKSSGFtdl-nftRERVTEIYFSPASFIFEpeFSKCR 607 Abies grandis
AAC05727  247 wlk--------sniNQKMLKLAKLDFNILQCKHHKEIQFITRWWRDSGIsql-nfyRKRHVEYYSWVVMCIFEpeFSESR 317 white fir
AAC05728  259 elk--------snlSKKMLELAKLDFNILQCTHQKELQIISRWFADSSIasl-nfyRKCYVEFYFWMAAAISEpeFSGSR 329 white fir
T02959    505 vwigktlyrmplvnNDTYLELAIRDFNHCQALHQLECNGLQTWYKDNCLdaf-gvePQDVLRSYFLAAACIFEpsRAAER 583 Zea mays
BAB12440  503 vwigktlyrmgnvsNNTYLEMAKLDYNNCLAIHHLEWNTMQQWYVDFGMerfgtsdITSLLVSYYLAAASVFEpeRSKER 582 garden lettuce
AAK83562  474 riakcv-yklpyvnNEKFLELGKLDFNIIQSIHQEEMKNVTSWFRDSGLplf-tfaRERPLEFYFLVAAGTYEpqYAKCR 551 white fir
NP_192187 511 yrm-------pyvnNNGYLELAKQDYNNCQAQHQLEWDIFQKWYEENRLsew-gvrRSELLECYYLAAATIFEseRSHER 582 thale cress
AAL09965  533 wlgktv-ykmlyvsNEKYLELAKLDFNMVQALHQKETQHIVSWWRESGFndl-tftRQRPVEMYFSVAVSMFEpeFAACR 610 maidenhair tree
Q9FT37    524 werktl-yrmpslsNSKCLELAKLDFNIVQSLHQEELKLLTRWWKESGMadi-nftRHRVAEVYFSSATFEPE--YSATR 599 Chinese yew
Feature 1           # ###  #   #                                                              
5EAT      288 VMLVKTISMISIVDDTFDAYGtvkeleaytdaiq-rwdineidrlpdyMKISYKAILDLYKDYEkelssag-rshivcHA 365 common tobacco
AAB05407  608 EVYTKTSNFTVILDDLYDAHGslddlklftesvk-rwdlslvdqmpqqMKICFVGFYNTFNDIAkegrerq-grdvlgYI 685 Abies grandis
AAC05727  318 IAFAKTAILCTVLDDLYDTHAtlheikimtegvr-rwdlsltddlpdyIKIAFQFFFNTVNELIveivkrq-grdmttIV 395 white fir
AAC05728  330 VAFTKIAILMTMLDDLYDTHGtldqlkiftegvr-rwdvslveglpdfMKIAFEFWLKTSNELIaeavkaqgqdmaayIR 408 white fir
T02959    584 LAWARTSMIANAISTHLRDISedk----------------------krLECFVHCLYEENDVSWlkrn------pndvIL 635 Zea mays
BAB12440  583 IAWAKTTTLVDTISSFFHSLKisn----------------------ehRREFVEEFRNISNSIHhakyg-----kpwhGL 635 garden lettuce
AAK83562  552 FLFTKVACLQTVLDDMYDTYGtldelklfteavr-rwdvsftenlpdyMKLCYQIYYDIVHEVAweaekeq-grelvsFF 629 white fir
NP_192187 583 MVWAKSSVLVKAISSSFGESSd-------------------------sRRSFSDQFHEYIANARrs----------dhHF 627 thale cress
AAL09965  611 IAYAKTSCLAVILDDLYDTHGslddlklfseavrrwdisvldsvrdnqLKVCFLGLYNTVNGFGkdglkeq-grdvlgYL 689 maidenhair tree
Q9FT37    600 IAFTKIGCLQVLFDDMADIFAtldelksftegvk-rwdtsllheipecMQTCFKVWFKLIEEVNndvvkvq-grdmlaHI 677 Chinese yew
Feature 1               #                                                                     
5EAT      366 IERMKEVVRNYNVESTWfiegy------------tppvSEYLSNALAtttyYYLATTSYLgmk--------------sat 419 common tobacco
AAB05407  686 QNVWKVQLEAYTKEAEWseaky------------vpsfNEYIENASVsialGTVVLISALftge-------------vlt 740 Abies grandis
AAC05727  396 KDCWKRYIESYLQEAEWiatgh------------iptfNEYIKNGMAssgmCILNLNPLLlldk-------------llp 450 white fir
AAC05728  409 KNAWERYLEAYLQDAEWiatgh------------vptfDEYLNNGTPntgmCVLNLIPLLlmge-------------hlp 463 white fir
T02959    636 ERALRRLINLLAQEALPih-----------------egQRFIHSLLSla-wTEWMLQKANkeenkyhkcsgiepqymvhd 697 Zea mays
BAB12440  636 MVALKGTLHEIALDVLMth------------------rRDIHPQLHHa--wEMWLMRWQQgvd---------------at 680 garden lettuce
AAK83562  630 RKGWEDYLLGYYEEAEWlaaey------------vpslDEYIKNGITsigqRILLLSGVLimdg------------qlls 685 white fir
NP_192187 628 NDRNMRLDRPGSVQASRlagvligtlnqmsfdlfmshgRDVNNLLYLs--wGDWMEKWKLyg-----------------d 688 thale cress
AAL09965  690 RKVWEGLLASYTKEAEWsaaky------------vptfNEYVENAKVsialATVVLNSIFftge-------------llp 744 maidenhair tree
Q9FT37    678 RKPWELYFNCYVQEREWldagy------------iptfEEYLKTYAIsvglGPCTLQPILlmge-------------lvk 732 Chinese yew
Feature 1                            ## ##  #   #                                             
5EAT      420 EQDFEWLSKn--PKILEASVIICRVIDDTATYEVEk-SRGQiATGIECCMRdyg--istKEAMAKFQNMAETAWKDINEG 494 common tobacco
AAB05407  741 DEVLSKIDRe--SRFLQLMGLTGRLVNDTKTYQAEr-GQGEvASAIQCYMKdhpk-iseEEALQHVYSVMENALEELNRE 816 Abies grandis
AAC05727  451 DNILEQIHSp--SKILDLLELTGRIADDLKDFEDEk-ERGEmASSLQCYMKenpe-stvENALNHIKGILNRSLEEFNWE 526 white fir
AAC05728  464 IDILEQIFLp--SRFHHLIELASRLVDDARDFQAEk-DHGD-LSCIECYLKdhpe-stvEDALNHVNGLLGNCLLEMNWK 538 white fir
T02959    698 RQTYLLLVQv--IEICAGRIGEAVSMINNKDNDWFiqLTCAtCDSLNHRMLlsqdtmknEARINWIEKEIELNMQELAQS 775 Zea mays
BAB12440  681 EGQAELIVQt--INMTAGRWVSNELLAHPQYRLLSs-VINNiCHEIYHNRTc------mEVNSTTISTSIDSKMQELVQL 751 garden lettuce
AAK83562  686 QEALEKVDYpgrRVLTELNSLISRLADDTKTYKAEk-ARGElASSIECYMKdhpe-cteEEALDHIYSILEPAVKELTRE 763 white fir
NP_192187 689 EGEGELMVKm--IILMKNNDLTNFFTHTHFVRLAE--IINR-ICLPRQYLKar-----rNDEKEKTIKSMEKEMGKMVEL 758 thale cress
AAL09965  745 DYILQQVDLr--SKFLHLVSLTGRLINDTKTYQAEr-NRGElVSSVQCYMRenpe-cteEEALSHVYGIIDNALKELNWE 820 maidenhair tree
Q9FT37    733 DDVVEKVHYp--SNMFELVSLSWRLTNDTKTYQAEk-ARGQqASGIACYMKdnlg-ateEDAIKHICRVVDRALKEASFE 808 Chinese yew
Feature 1                                  #    # #                   
5EAT      495 LLrp---tpVSTEFLT-PILNLARIVEVTYihnLDGYthpe-evlKPHIINLLVDS 545 common tobacco
AAB05407  817 FVnn----kIPDIYKR-LVFETARIMQLFYm-qGDGLtlshdmeiKEHVKNCLFQP 866 Abies grandis
AAC05727  527 FMkq---dsVPMCCKK-FTFNIGRGLQFIYk-yRDGLyisd-kevKDQIFKILVHQ 576 white fir
AAC05728  539 FLkkq--dsVPLSCKKySFHVLARSIQFMYn-qGDGFsisn-kviKDQVQKVLIVP 590 white fir
T02959    776 LLlrcdektSNKKTKK-TLWDVLRSLYYATh--SPQHm------iDRHVSRVIFEP 822 Zea mays
BAB12440  752 VLsds-lddLDQDLKQ-TFLTVAKTFYYKAy--CDPEt------iNVHISKVMFET 797 garden lettuce
AAK83562  764 FLkp---ddVPFACKK-MLFEETGVTMVIFk-dGDGFgvsk-levKDHIKECLIEP 813 white fir
NP_192187 759 ALse---sdTFRDVSI-TFLDVAKAFYYFA---LCGDh------lQTHISKVLFQK 801 thale cress
AAL09965  821 LAnpa--snAPLCVRR-LLFNTARVMQLFYm-yRDGFgisd-kemKDHVSRTLFDP 871 maidenhair tree
Q9FT37    809 YFkps--ndIPMGCKS-FIFNLRLCVQIFYk-fIDGYgian-eeiKDYIRKVYIDP 859 Chinese yew

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap