1I0Z,5MDH,1CIV,1EZ4,1GUZ,1HYH,1IB6,1OBB,1S6Y,1U8X,1UP7,1Y6J


Conserved Protein Domain Family
LDH_MDH_like

?
cd00650: LDH_MDH_like 
Click on image for an interactive view with Cn3D
NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family
Members of this family include ubiquitous enzymes like L-lactate dehydrogenases (LDH), L-2-hydroxyisocaproate dehydrogenases, and some malate dehydrogenases (MDH). LDH catalyzes the last step of glycolysis in which pyruvate is converted to L-lactate. MDH is one of the key enzymes in the citric acid cycle, facilitating both the conversion of malate to oxaloacetate and replenishing levels of oxalacetate by reductive carboxylation of pyruvate. The LDH/MDH-like proteins are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
Statistics
?
PSSM-Id: 133419
View PSSM: cd00650
Aligned: 14 rows
Threshold Bit Score: 163.259
Threshold Setting Gi: 31615790
Created: 7-Mar-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 15 residues -Click on image for an interactive view with Cn3D
Feature 1:NAD(P) binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1            ## #                         ##                                          
1I0Z_A     23 ITVVGV-GQ-VGMACAISILgks-----ladELALVDVLe--dKLKGEMMDLQHGSlfl--qtpKIVADKd---YSVTAN 88  human
5MDH_A      6 VLVTGAaGQ-IAYSLLYSIGngsvfgkdqpiILVLLDITpmmgVLDGVLMELQDCAlpl---lkDVIATDk--eEIAFKD 79  pig
1GUZ_A      3 ITVIGA-GN-VGATTAFRLAekq-----larELVLLDVVe--gIPQGKALDMYESGpvgl-fdtKVTGSNd---YADTAN 69  Prosthecochloris v...
1IB6_A      3 VAVLGAaGG-IGQALALLLKtqlp----sgsELSLYDIAp---VTPGVAVDLSHIPta-----vKIKGFSgedaTPALEG 69  Escherichia coli
1OBB_B      6 IGIIGAgSAvFSLRLVSDLCktpg---lsgsTVTLMDIDe--eRLDAILTIAKKYVeevg-adlKFEKTMn--lDDVIID 77  Thermotoga maritima
1S6Y_A     10 IATIGGgSS-YTPELVEGLIkryhe--lpvgELWLVDIPegkeKLEIVGALAKRXVekag-vpiEIHLTLd--rRRALDG 83  Geobacillus stearo...
1U8X_X     31 IVIAGGgST-FTPGIVLXLLdhlee--fpirKLKLYDNDk--eRQDRIAGACDVFIreka-pdiEFAATTd--pEEAFTD 102 Bacillus subtilis
1UP7_A      5 IAVIGGgSS-YTPELVKGLLdised--vridEVIFYDIDe--eKQKIVVDFVKRLVkd----rfKVLISDt--fEGAVVD 73  Thermotoga maritima
1Y6J_A     10 VAIIGA-GF-VGASAAFTMAlrq-----tanELVLIDVFk--eKAIGEAMDINHGLpfm---gqMSLYAGd---YSDVKD 74  Clostridium thermo...
Q9EVR0      7 IVVIGA-SN-VGSAVANKIAdfq-----latEVVLIDLNe--dKAWGEAKDSSHATsciystniKFHLGD----YEDCKD 73  Selenomonas rumina...
Feature 1           ##                                             #                    ###   
1I0Z_A     89 SKIVVVTAgvrqqe--------------------------gesrlnLVQRNVnVFKFIIPQIVKys-pDCIIIVVSNPVD 141 human
5MDH_A     80 LDVAILVGsmprrd--------------------------gmerkdLLKANVkIFKCQGAALDKyakkSVKVIVVGNPAN 133 pig
1GUZ_A     70 SDIVIITAglprkp--------------------------gmtredLLMKNAgIVKEVTDNIMKhs-kNPIIIVVSNPLD 122 Prosthecochloris v...
1IB6_A     70 ADVVLISAgvarkp--------------------------gmdrsdLFNVNAgIVKNLVQQVAKtc-pKACIGIITNPVN 122 Escherichia coli
1OBB_B     78 ADFVINTAmvgghtylekvrqigekygyyrgidaqefnmvsdyytfSNYNQLkYFVDIARKIEKls-pKAWYLQAANPIF 156 Thermotoga maritima
1S6Y_A     84 ADFVTTQFrvgglearakderipl------kygvigqetngpgglfKGLRTIpVILDIIRDXEElc-pDAWLINFTNPAG 156 Geobacillus stearo...
1U8X_X    103 VDFVXAHIrvgkyaxraldeqipl------kygvvgqetcgpggiaYGXRSIgGVLEILDYXEKys-pDAWXLNYSNPAA 175 Bacillus subtilis
1UP7_A     74 AKYVIFQFrpgglkgrendegipl------kygligqettgvggfsAALRAFpIVEEYVDTVRKt--sNATIVNFTNPSG 145 Thermotoga maritima
1Y6J_A     75 CDVIVVTAganrkp--------------------------getrldLAKKNVmIAKEVTQNIMKyy-nHGVILVVSNPVD 127 Clostridium thermo...
Q9EVR0     74 ANIIVITAgpsirpg------------------------etpdrlkLAGTNAkIMSSVMGEIVKrt-kEAMIIMITNPLD 128 Selenomonas rumina...
Feature 1                            #   #                             #                      
1I0Z_A    142 ILTYVTwkls----glpkHRVIGSGcnLDSARFRYLMAEKLgih-psSCH-GWILGEHGDs-sVAVWsGVNvagvslqel 214 human
5MDH_A    134 TNCLTAsksap---sipkENFSCLTr-LDHNRAKAQIALKLgvt-sdDVKnVIIWGNHSSt-qYPDVnHAKvklqakevg 207 pig
1GUZ_A    123 IMTHVAwvrs----glpkERVIGMAgvLDAARFRSFIAMELgvs-mqDIN-ACVLGGHGDa-mVPVVkYTTvagipisdl 195 Prosthecochloris v...
1IB6_A    123 TTVAIAaevlkkagvydkNKLFGVTt-LDIICSNTFVAELKgkq-pgEVE-VPVIGGHSGvtiLPLLsQVPgvsfteqev 199 Escherichia coli
1OBB_B    157 EGTTLVtrt-------vpIKAVGFX--HGHYGVMEIVEKLGle--eeKVD-WQVAGVNHG---IWLN-RFRynggnaypl 220 Thermotoga maritima
1S6Y_A    157 XVTEAVlry------tkqEKVVGLC--NVPIGXRXGVAKLLgvd-adRVH-IDFAGLNHX---VFGL-HVYldgvevtek 222 Geobacillus stearo...
1U8X_X    176 IVAEATrrl------rpnSKILNIC--DXPVGIEDRXAQILglssrkEXK-VRYYGLNHF---GWWT-SIQdqegndlxp 242 Bacillus subtilis
1UP7_A    146 HITEFVrny------leyEKFIGLC--NVPINFIREIAEMFsar-leDVF-LKYYGLNHL---SFIE-KVFvkgedvtek 211 Thermotoga maritima
1Y6J_A    128 IITYMIqkws----glpvGKVIGSGtvLDSIRFRYLLSEKLgvd-vkNVH-GYIIGEHGDs-qLPLWsCTHiagkniney 200 Clostridium thermo...
Q9EVR0    129 VATYVVstqf----dyprNLILGTGtmLETYRFRRILADKYqvd-pkNIN-GYVLGEHGNa-aFVAWsTTGcagfpiddl 201 Selenomonas rumina...
Feature 1                                                                                     
1I0Z_A    215 npemgtdndsenwk------------------------------------------------------------------ 228 human
5MDH_A    208 vyeavkddswlkge------------------------------------------------------------------ 221 pig
1GUZ_A    196 lpaetidklver-------------------------------------------------------------------- 207 Prosthecochloris v...
1IB6_A    200 adltkriqn----------------------------------------------------------------------- 208 Escherichia coli
1OBB_B    221 ldkwieekskdwkpenpfndqlspaaidmyrfygvmpigdtvrnsswryhrdletkkkwygepwggadseigwkwyqdtl 300 Thermotoga maritima
1S6Y_A    223 vidlvahpdrsgvtxknivdlgwepdflkglkvlpcpyhryyfq-----------------------------------t 267 Geobacillus stearo...
1U8X_X    243 klkehvsqygyipkteaeaveaswndtfakardvqaadpdtlpnty-------------------------------lqy 291 Bacillus subtilis
1UP7_A    212 vfenlklklsnipdedfptwfydsvrlivnpylryylm------------------------------------------ 249 Thermotoga maritima
1Y6J_A    201 iddpkcnfteedkk------------------------------------------------------------------ 214 Clostridium thermo...
Q9EVR0    202 deyfhrteklshea------------------------------------------------------------------ 215 Selenomonas rumina...
Feature 1                                                        #                            
1I0Z_A    229 ----------------------------evhkmvvesayeviklkgytnwaIGLSVADLIESMLkn----lsRIHPVSTM 276 human
5MDH_A    222 ----------------------------fittvqqrgaavikarklssamsAAKAICDHVRDIWfgt--pegEFVSMGII 271 pig
1GUZ_A    208 -------------------------------trnggaeivehlkqgsafyaPASSVVEMVESIVld----rkRVLPCAVG 252 Prosthecochloris v...
1IB6_A    209 ---------------------------------agtevveakagggsatlsMGQAAARFGLSLVralqgeqgVVECAYVE 255 Escherichia coli
1OBB_B    301 gkvteitkkvakfikenpsvrlsdlgsvlgkdlsekqfvlevekildperkSGEQHIPFIDALLnd----nkARFVVNIP 376 Thermotoga maritima
1S6Y_A    268 dkxlaeeleaaktkgtraevvqqlekelfelykdpnlaikppqlekrggayYSDAACSLISSIYnd----krDIQPVNTR 343 Geobacillus stearo...
1U8X_X    292 ylfpddxvkksnpnhtranevxegreafifsqcdxitreqssenseikiddHASYIVDLARAIAyn----tgERXLLIVE 367 Bacillus subtilis
1UP7_A    250 -----ekkmfkkisthelrarevmkiekelfekyrtaveipeeltkrggsmYSTAAAHLIRDLEtd----egKIHIVNTR 320 Thermotoga maritima
1Y6J_A    215 ----------------------------kiaedvktagatiiknkgatyygIAVSINTIVETLLkn----qnTIRTVGTV 262 Clostridium thermo...
Q9EVR0    216 -----------------------------veqelvqvaydvinkkgftntgIAMAACRFIKSVLyd----ehTILPCSAV 262 Selenomonas rumina...
Feature 1                                                             
1I0Z_A    277 VKgmyg-ieneVFLSLPCILNARGltsVIN-QKLk--dDEVAQLKKSADTLWDIQK 328 human
5MDH_A    272 SDgnsygvpddLLYSFPVTIKDKTw-kIVEgLPIn--dFSREKMDLTAKELAEEKE 324 pig
1GUZ_A    253 LEgqyg--idkTFVGVPVKLGRNGveqIYE-INLd--qADLDLLQKSAKIVDENCK 303 Prosthecochloris vibrioformis
1IB6_A    256 GDgq-----yaRFFSQPLLLGKNGveeRKSiGTLs--aFEQNALEGMLDTLKKDIA 304 Escherichia coli
1OBB_B    377 NKgiihgidddVVVEVPALVDKNGi-hPEKiEPPlpdrVVKYYLRPRIMRMEMALE 431 Thermotoga maritima
1S6Y_A    344 NNgaiasisaeSAVEVNCVITKDGp-kPIA-VGDlp-vAVRGLVQQIKSFERVAAE 396 Geobacillus stearothermophilus
1U8X_X    368 NNgaianfdptAXVEVPCIVGSNGp-ePIT-VGTip-qFQKGLXEQQVSVEKLTVE 420 Bacillus subtilis
1UP7_A    321 NNgsienlpddYVLEIPCYVRSGRv-hTLS-QGKgd-hFALSFIHAVKMYERLTIE 373 Thermotoga maritima
1Y6J_A    263 INgmyg--iedVAISLPSIVNSEGvqeVLQ-FNLt--pEEEEALRFSAEQVKKVLN 313 Clostridium thermocellum
Q9EVR0    263 LEgeyg--ikdVALSIPRMVCADGimrSFE-VHLt--dDELEKMHKAAQSVRSALD 313 Selenomonas ruminantium

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap