1ITK,2FXG,1SJ2,1UB2


Conserved Protein Domain Family
catalase_peroxidase_1

?
cd00649: catalase_peroxidase_1 
Click on image for an interactive view with Cn3D
N-terminal catalytic domain of catalase-peroxidases.
This is a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Catalase-peroxidases can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. These enzymes are found in many archaeal and bacterial organisms, where they neutralize potentially lethal hydrogen peroxide molecules generated during photosynthesis or stationary phase. Along with related intracellular fungal and plant peroxidases, catalase-peroxidases belong to class I of the plant peroxidase superfamily. Unlike the eukaryotic enzymes, they are typically comprised of two homologous domains that probably arose via a single gene duplication event. The heme binding motif is present only in the N-terminal domain; the function of the C-terminal domain is not clear.
Statistics
?
PSSM-Id: 173824
View PSSM: cd00649
Aligned: 24 rows
Threshold Bit Score: 737.964
Threshold Setting Gi: 196191312
Created: 6-Mar-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 24 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:
  • Comment:The enzyme is a dimer of two identical subunits; each subunit is composed of two structurally homologous domains with a topology similar to that of class I peroxidase. The active site is in the N-terminal domain.
  • Comment:Active site includes heme-binding residues; these structures do not have substrate bound.
  • Structure:1ITK: Haloarcula marismortui catalase peroxidase; contacts at 4.0A
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                              ## ##  #  
1ITK_A        18 KRPKSNQDWWPSKLNLEILDQNardvgpveDDFDYAEEFQKLDlEAVKSDLEELMTSSQDWWPADYGHYGPLFIRMAWHS 97  Haloarcula mari...
Q67LP5        11 GHGTSNKDWWPNQLNLRILHQHsekanpmgPDFNYREEFKKLDyWALKEDLRKLMTESQDWWPADFGHYGPLIIRMAWHS 90  Symbiobacterium...
Q8X182        13 GGGTRNHDWWPAQLRLNILRQHtpvsnpldKDFDYAAAFKSLDyEGLKKDLTKLMTDSQDWWPADFGHYGGLFIRMAWHS 92  Neurospora crassa
B3E099        16 GGLKTNEEWWPNRLNLKILRQNsplsnpmgAGFNYAKEFCSLDlSALKEDLRRLMTDSQQWWPADFGHYGPLFIRMAWHS 95  Methylokorus in...
ACN30868      18 GHGVTHQKWWPEALKTNILRQHsavtnpygENFNYAEAFNSIDyNELKEDLRKVCRDSQDWWPADFGHYGGLFVRMSWHA 97  maize
YP_002730748  18 EGGNTISKWWPHRLNLKILQQNnpdlvpfdKNFNYREEFSKLDyFELKEDIRRIMRESQEWWPADYGHYGPLFIRMAWHS 97  Persephonella m...
9972733       11 ARKRWITDWWPNRLNLKILRQNlqn--pygEDYDYVEEVENLDiDAVIRDLKELMRSSQDWWPADFGHYGPLFIRLAWHS 88  Archaeoglobus f...
EDX86276      24 GSKPQTDDWWPNRLQVELLHQEspka-nplRDVDYREAFEKIDfEQLKSDIKALLTDSQDWWPADYGNYGPQMIRMTWHS 102 Synechococcus s...
ACI65560      15 KAASANSYWWPDNINLKILNQQgan--npdPSFNYKEAFRELDvEMVKRDVNKMLTTSQDWWPADWGHYGPFMIRMAWHA 92  Phaeodactylum t...
YP_001470835   8 SRKRWITDWWPNRLNLKILRQNcsdsnpygSDYDYLKEVKTLDvDAVIEDLKKLMKTSQDWWPADFGHYGPLFIRLSWHS 87  Thermotoga lett...
Feature 1                                                                                        
1ITK_A        98 AGTYRTADGRGGAAGGRQRFAPINSWPDNANLDKARRLLLPIKQKYGQKISWADLMILAGNVAIESMGFKTFGYAGGRED 177 Haloarcula mari...
Q67LP5        91 AGTYRIQDGRGGAESGAQRFAPLNSWPDNINLDKARRLLWPIKQKYGRRISWADLMILAGNVALESMGLKTIGFAGGRAD 170 Symbiobacterium...
Q8X182        93 AGTYRVTDGRGGGGEGQQRFAPLNSWPDNVSLDKARRLLWPIKQKYGNKISWSDLLLLTGNVALESMGFKTFGFAGGRPD 172 Neurospora crassa
B3E099        96 AGTYRVHDGRGGAGSGQQRFAPLNSWPDNVLLDKARRLLWPIKQKYGRKISWADLIILAGNVALESMGLKTFGFGGGRVD 175 Methylokorus in...
ACN30868      98 VGTYRVFDGRGGGRQGQQRFAPLNSWPDNVSLDKARRLLWPVKQKYGNKVSWADLIVMAGNVALEDMGFKTIGFAAGRPD 177 maize
YP_002730748  98 AGTYRIIDGKGGANGGNQRFAPVNSWPDNVNLDRARRLLWPVKKKYGNKISWADLMILAGNVALEDMGFKTIGFGGGRED 177 Persephonella m...
9972733       89 AGSYRIFDGRGGARDGSIRFPPRINWPDNINLDKAIRLLWPIKKKYGRKLSWADLIILAGTVAMEDMGVKLFGFALGRED 168 Archaeoglobus f...
EDX86276     103 AGTYRIADGRGGAAQGMQRFAPINSWWDNGNTDKSRRLLWPIKQKYGASLSWADLMVLVGNCALEIMGFKTFGFGGGRID 182 Synechococcus s...
ACI65560      93 AGTYRISDGRGGANTANQRFAPLNSWPDNANLDKARRLMWPVKQKYGRKLSWGDLMMLTGNQALEIMGLKTIGFAFGRED 172 Phaeodactylum t...
YP_001470835  88 AGSYRIHDGRGGAKNGSIRFPARINWPDNINLDKAIRLLWPIKKKYGKKLSWADLIILAGTVALQDMGVKILGFSLGRED 167 Thermotoga lett...
Feature 1                                                                              # #       
1ITK_A       178 AFEEDKaVNWGPEDEFETQe-----RFDEPg------------------------EIQEGLGASVMGLIYVNPEGPDGNP 228 Haloarcula mari...
Q67LP5       171 VWEPEEdIYWGSEQQWLGRd-----RFGEEg------------------------KLEDPLAASEMGLIYVNPEGPGREP 221 Symbiobacterium...
Q8X182       173 TWEADEsVYWGAETTWLGNe----dRYSEGqegheghgvvqgdeskkqhtdihnrDLQSPLASSHMGLIYVNPEGPDGIP 248 Neurospora crassa
B3E099       176 SWEPDEsVYWGVEQKWLEDk-----RYSGKr------------------------DLEQPLAAVQMGLIYVNPEGPNGNP 226 Methylokorus in...
ACN30868     178 TWEADEaTYYGGEDTWLGNd----vRYSDGhpgttkpgatds--dqaphknihtrELEKPLAAAHHGLIYVNPEGPDGNP 251 maize
YP_002730748 178 IWEPEIdTYWGPETEWLADm-----RHSEEg------------------------KIKGPLAAVQMGLIYVNPEGPNGEP 228 Persephonella m...
9972733      169 IFEPDEsPDWGPEEEMLTAk-----RGEKE-------------------------ELERPFAATEMGLIYVNPEGPGGNP 218 Archaeoglobus f...
EDX86276     183 AWEADRaTYWGPEFWNGQSfgengkKHAGHpdemvtrdir-----wvgepdneyyDLENPLAASHQALIYVNPEGPNGEG 257 Synechococcus s...
ACI65560     173 IYSPEDdVYWGPEKEMLSNd-----RFDENg------------------------DIKRPLGASEMGLIYVNPEGHDNEP 223 Phaeodactylum t...
YP_001470835 168 VFEADEsPDWGAEQEMLSGk----eRFKEG-------------------------ELEKPFAATEMGLIYVNPEGPMGNP 218 Thermotoga lett...
Feature 1                    #            ##  ## #####                                      ##   
1ITK_A       229 DPEASAKNIRQTFDRMAMNDKETAALIAGGHTFGKVHGADDPeenLGPEPEAAPIEQQGLGWQNKNGNSKGGEMITSGIE 308 Haloarcula mari...
Q67LP5       222 DPLKAAQQIRETFKRMGMNDEETVALIAGGHTFGKTHGAASPs-hLGPEPEAAPIEEMGLGWKNSYGTGKGGDTITSGLE 300 Symbiobacterium...
Q8X182       249 DPVASAKDIRVTFGRMAMNDEETVALIAGGHSFGKTHGAGPTh-hVGKEPEAAPIEHQGLGWANSFGQGKGPDTITSGLE 327 Neurospora crassa
B3E099       227 DPVAAAVDIRETFTRMGMNDAETVALIAGGHTFGKAHGAGPAs-fVGPEPEAAGIAEQGLGWRSSYRSGKGADAIGSGLE 305 Methylokorus in...
ACN30868     252 DPVAAARDIRETFGRMAMNDEETVALIAGGHTVGKTHGAGSTd-hVGPEPEAADLAQQGLGWSNSYKTGKGPHTTTSGLE 330 maize
YP_002730748 229 DVLGAAKDIKESFGKMGMSIEETVALIAGGHTFGKCHGAADPskyLGPEPEAAPIEQQGLGWKNSYGTGKGKDTITSGLE 308 Persephonella m...
9972733      219 DPLGSAQEIRVAFRRMGMNDEETVALIAGGHAFGKCHGAGPAd-yLGPDPSSSPIEMQGLGWKYNYGKGKGSDTFTSGLE 297 Archaeoglobus f...
EDX86276     258 DPAASARDIRETFARMAMNDEETVALIAGGHAFGKSHGMVSSd-kIGPAPEGAPIQAMGLGWQNPEGTGFAEYTMTNGIE 336 Synechococcus s...
ACI65560     224 NPTKSAHDIRQTFRNMAMDDYETVALIAGGHTFGKTHGAAPVs-hQGPEPEGASIEHQQLGYLSDYGTGKGKDTTTSGLE 302 Phaeodactylum t...
YP_001470835 219 DPSGSAKEIRLAFTRMGMNDEETVALIAGGHSFGKCHGAGPSk-dLGPDPSSSPIEQMGLGWKYTYKTGKASDTYTSGFE 297 Thermotoga lett...
Feature 1          #                                                         # #                 
1ITK_A       309 GPWTqSPTEWDMGYINNLLDYEWEPEKGPGGAWQWAPKseelkNSVPDAHDPdEKQTPMMLTTDIALKRDPDYREVMETF 388 Haloarcula mari...
Q67LP5       301 VTWTsSPTKWTSNFLWNLFGYEWELTKSPAGAWQWRPKngageGTVPDAHDPnKRHAPGMLTTDIALRVDPVYEKIARRF 380 Symbiobacterium...
Q8X182       328 VTWTpTPTKWGMGYLEYLYKFDWEPTKSPAGANQWVAKna--ePTIPDAYDPnKKKLPTMLTTDIALRMDPAYDKICRDY 405 Neurospora crassa
B3E099       306 VIWTrTPTRWNNDYFQFLFEYEWEPTKSPAGAWQWVAKda--pEIVPDPFDPaKKRKPTMLTTDLSLRFDPVYEKIARAY 383 Methylokorus in...
ACN30868     331 VTWTsTPVKWSHDYLKYLFQFEWELTKSPAGAHQWVAKda--nATVPDAFDPnKKQKPTMLTTDLSLRFDPEYEKISRRF 408 maize
YP_002730748 309 GAWTpTPIKWDNSFLRILFKYEWNLQKSPAGAWQWVAVnpdreDLVPDAHIPgKYHPPIMLTTDLALKLDPELSEVSKRF 388 Persephonella m...
9972733      298 VTWSpTPTKFGINYLRILFTYEWELEKSPAGKNQWVAKda--pEIIPDAHDPnKKHRPRMLTADLALRFDPEFSKIARRF 375 Archaeoglobus f...
EDX86276     337 GSWTpNPTQWDNSYLTNLFKYEWEKTESPSGAVQWKPSns-daPKTPDAHKPgVEHNLMMMTSDIALRVDPAYNEICQRY 415 Synechococcus s...
ACI65560     303 GAWTeTPIQWDMNYFKNLFEYEWEVHKGPGGRHQWRPTdkstfEMVPDAHEKgKKNPPMMFTTDISLKIDPIYGPISRHF 382 Phaeodactylum t...
YP_001470835 298 VIWSsKPTKFGIQYLKFLLEFEWELEKSPDGKNQWVAKna--pEMIPDPFDPnKKHKPRMLTADLALKFDPIYSKIAKKF 375 Thermotoga lett...
Feature 1                  #   #                        
1ITK_A       389 QENPMEFGMNFAKAWYKLTHRDMGPPERFLGPEVPDEEM 427 Haloarcula marismortui
Q67LP5       381 LENPDEFAKAFARAWFKLTHRDLGPRSRYLGPEVPEEEF 419 Symbiobacterium thermophilum
Q8X182       406 LANPDKFADAFARAWFKLLHRDMGPRTRWIGPEVPSEIL 444 Neurospora crassa
B3E099       384 YEQPDLFADAFARAWFKLTHRDMGPRSRYLGPEVPKEDL 422 Methylokorus infernorum V4
ACN30868     409 LENPDEFNEAFAKAWFKLTHRDMGPRDRYLGPEVPKEVF 447 maize
YP_002730748 389 LEDPEYFRDAFAKAWFKLTHRDLGPKWRYLGPEVPEEDF 427 Persephonella marina EX-H1
9972733      376 LENPEEFEKAFAIAWYKLTHRDMGPKDCYIGKYVPEETF 414 Archaeoglobus fulgidus
EDX86276     416 LNDFDHFSDAFSRAWYKLTHRDLGPKTRYLGPEVAEEDL 454 Synechococcus sp. PCC 7335
ACI65560     383 YHHPDEFSAAFAKAWYKLLHRDMGPVSRCLGSDVPEPQL 421 Phaeodactylum tricornutum CCAP 1055/1
YP_001470835 376 LENPEEFEKAFAWAWFKLTHRDMGPKSCYIGPYVPREEF 414 Thermotoga lettingae TMO

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap