1QAX,1QAY,1QAY,1QAX


Conserved Protein Domain Family
HMG-CoA_reductase_classII

?
cd00644: HMG-CoA_reductase_classII 
Click on image for an interactive view with Cn3D
Class II hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase (HMGR)
Hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase (HMGR), class II, prokaryotic enzyme is a homodimer. Class II enzymes are found primarily in prokaryotes and Archaeoglobus fulgidus and are soluble as they lack the membrane region. Enzymes catalyze the synthesis of coenzyme A and mevalonate in isoprenoid synthesis. Bacteria, such as Pseudomonas mevalonii, which rely solely on mevalonate for their carbon source, catalyze the reverse reaction, using an NAD-dependent HMGR to deacetylate mevalonate into 3-hydroxy-3-methylglutaryl-CoA. Human and bacterial HMGR differ in their active site architecture.
Statistics
?
PSSM-Id: 153082
View PSSM: cd00644
Aligned: 82 rows
Threshold Bit Score: 477.756
Threshold Setting Gi: 227507039
Created: 6-Mar-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:catalytic residues [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
1QAX_A         8 PAFRNLSPAARLDHIGql-lgLSHDDVSLLana----galPMDIANGMIENVIGTFELPYAVASNFQINGRDVLVPLVVE 82  Pseudomonas mev...
1QAY_A         8 PAFRNLSPAARLDHIGql-lgLSHDDVSLLana----galPMDIANGMIENVIGTFELPYAVASNFQINGRDVLVPLVVE 82  Pseudomonas mev...
ZP_01201660   47 IGFSKLSKTEKVNWLVdtyfdGNTAAHDTItrywn-qdqkLQELHDGFSENTITNYYFPFGLAPNFLIDGKLVTIPMAIE 125 Flavobacteria b...
ZP_04057923    3 KGFSKLTKEEKRQWICqq-ylSDPSQSEVFtsydl-rdenLQKLHDDFIENTIGNYMLPFAVAPNFLIDGHYYTVPMVLE 80  Capnocytophaga ...
YP_003141153   5 DGFSKLTKAQKIAWLCdt-yfPNIENAASFfekyhnadtdLQKLHDEFIENTVSNYYLPFAVAPNFLINGRTYTVPMAIE 83  Capnocytophaga ...
YP_812849      1 MKFYQLPPEERRQFLQed--gVALEDIPAA----------DLARLDEMSENVVGEVKFPLSCLTSALVNGKNWRIPMTTE 68  Lactobacillus d...
YP_001577104   1 MKFYQLKPEQRREILQse--gINLEDIDDQ----------VLNRLDKLSENVVGQLRLPLGVVQNFLLNGQSYMVPMAVE 68  Lactobacillus h...
NP_968510     10 KGFSKLSREERLKALKev-gaLNEAEADYLakg----glkDTSLGEKFIENVIGYFQLPLGVVTNMRVDGKDFVVPMAVE 84  Bdellovibrio ba...
YP_001250833  12 RGFSKLSREERFQRLCal-gaLTHEDITFLkqg----gikDLNLADKLIENVIGYFQLPLGVATNFNIDGRDYVIPLAVE 86  Legionella pneu...
ZP_04645262    1 MKFYQLPISERRKMLLqn--gIKLNHVDDD----------LLSELDLLSENVIGKLTLPLSVLQTAIVNGQSFQVPMATE 68  Lactobacillus j...
Feature 1        #                                                                               
1QAX_A        83 EPSIVAAASYMAKLARAnggFTTSSSAPLMHAQVQIVGiqdPLNARLSLLRr-KDEIIELANRKdq-lLNSLGGGCRDIE 160 Pseudomonas mev...
1QAY_A        83 EPSIVAAASYMAKLARAnggFTTSSSAPLMHAQVQIVGiqdPLNARLSLLRr-KDEIIELANRKdq-lLNSLGGGCRDIE 160 Pseudomonas mev...
ZP_01201660  126 ESSVVAAASKAAKFWLNrggFKTKVRSTVKSGQVHIMYn-gLHGEMDAFYAfaKADLLQSVQSIna-sMKKRGGGLLDLQ 203 Flavobacteria b...
ZP_04057923   81 ESSVVAAVSKAAKFWSEqggFLCQVRSMEKVGHIHLFFegdKHELFQFFSTi-EPLLYEQTQGIte-nMRKRGGGISSII 158 Capnocytophaga ...
YP_003141153  84 ESSVVAAASRAAKFWQSrggFHTEVLSTEKTGHVHFFFygeKTNLENFFNHi-QPLMLAKAQPIta-nMEKRGGGITSLT 161 Capnocytophaga ...
YP_812849     69 EASVVAAANHGMSVFAKaggVKATSQRDGIYGQIVLEVt--EAFSLAGFKKe-FPAYIKEANKEfa-sLIRHGGGLKDLT 144 Lactobacillus d...
YP_001577104  69 EPSVVAAANHGAHIFARnggVKATSKRTGIYGQIVLKVn--HDFSLPDLKKk-FPDLIDLANKEfa-sLIRHGGGTRSIE 144 Lactobacillus h...
NP_968510     85 ETSIVAACSKTAKWIREsgsITTEVIGNEIIGQIQLAKirsFADFEKQILAq-KNYLIEAANREvafgLVRRGGGVRDLQ 163 Bdellovibrio ba...
YP_001250833  87 ETSIIAALSKSAKWIRQhgeINTWVHGECILGQIQLAKvkdFHRFSDLFNKn-RQYFIEIANKDvaanMVKRGGGVTDLQ 165 Legionella pneu...
ZP_04645262   69 ESSVVAAANHGLNIFNQnggVSAKSERTGIWGQLVFEV---AEFSLAEFEAk-KPDYLKLVNEEfa-sLVKHGGGVRQII 143 Lactobacillus j...
Feature 1                                                                                        
1QAX_A       161 VHTFAdtprgPMLVAHLIVDVRDAMGANTVNTMAEAVAPLMEAITGg---------QVRLRILSNladlRLARAQVRITP 231 Pseudomonas mev...
1QAY_A       161 VHTFAdtprgPMLVAHLIVDVRDAMGANTVNTMAEAVAPLMEAITGg---------QVRLRILSNladlRLARAQVRITP 231 Pseudomonas mev...
ZP_01201660  204 LINKTdv-laGYYQLHATFETKDAMGANFINTTLEQLANTLREKANefqgfslgmpEVIMSILSNyvpeCVVNVSVSCTI 282 Flavobacteria b...
ZP_04057923  159 LKDMTds-leHYYQVFVTFLTGDAMGANFINSCLEKMSQTIEQEAIthls--hgalEVLMSILSNytpqCLVRAEVSAPV 235 Capnocytophaga ...
YP_003141153 162 LVDKTda-laHYYQLSATFETLDAMGANFINSCLESFAQTFREEAErdasi-gdkyEIVMSILSNyvpnCLVRAKVQCPI 239 Capnocytophaga ...
YP_812849    145 ARQEA-----DLVYLLALVDPAEAMGANKTNAILEFLAQKMLAFPGv--------eAKLFAILSNyp-sQLTTAKVAIPV 210 Lactobacillus d...
YP_001577104 145 AERKG-----DLVYLKVLVDPAEAMGANKTNSILEFLAAKLKQFPGi--------eEKLFAILSNyp-sQLTKATVTLDP 210 Lactobacillus h...
NP_968510    164 VRRVPrgdgsDMAVIHILMDPCDAMGANIINQVCEYLKEPIEQFSGe---------KVTMCILSNl--vDSKVTRAVVRI 232 Bdellovibrio ba...
YP_001250833 166 VRHLKredgqDMAVIHLTMNSCDAMGANIINQVLEYLKQPIEQITGe---------EVTMCILSNl--nDQKLTTAQVII 234 Legionella pneu...
ZP_04645262  144 AEVKT-----DLLFLRVLVDPAESMGANRTNTILEFLGQKISQDFTi---------EKLYAILSNyp-sQYTCAKVSLAF 208 Lactobacillus j...
Feature 1                                             #               #                          
1QAX_A       232 QQLETaefs--geaVIEGILDAYAFAAVDPYRAATHNKGIMNGIDPLIVATGNDWRAVEAGAHAYACRSGHYgsLTTWEK 309 Pseudomonas mev...
1QAY_A       232 QQLETaefs--geaVIEGILDAYAFAAVDPYRAATHNKGIMNGIDPLIVATGNDWRAVEAGAHAYACRSGHYgsLTTWEK 309 Pseudomonas mev...
ZP_01201660  283 NEIGTingv-sgedFARKFTRAVDIATVEPYRAVTHNKGIMNGIDAVVIATGNDFRAVEAGVHAYAARDGQYrsLTRARV 361 Flavobacteria b...
ZP_04057923  236 SRMSFndie--gkvFATDFTRAIAVANADVYRAVTHNKGVMNGIDAVVIATGNDFRAVEAAVHAYAAKEGRYksLTQAYI 313 Capnocytophaga ...
YP_003141153 240 EELEIaqlk--gaeAAKKFVQALAIANADVYRATTHNKGIMNGIDSVILATGNDFRAIEAGAHAYAARSGQYksLSAAWI 317 Capnocytophaga ...
YP_812849    211 SLLSKkgdlaegreVAKKMALLAKIGSSDPYRAVTNNKGIMNGVDAVMLATGNDYRAVEAACHAYAAKSGEYrsLSSWKI 290 Lactobacillus d...
YP_001577104 211 KTMGGr-------kVAERVALLSKIGYEDPYRAVTNNKGIMNGVDAVLIATGNDYRAIESATAVLASQDGHYrsLSKWTM 283 Lactobacillus h...
NP_968510    233 DDIEPe--------LAEKIEEASLFAQMDPYRAATNNKGVLNGIDPILIATGNDWRAVEAGIHAYACRDGQYrsITRWYR 304 Bdellovibrio ba...
YP_001250833 235 RNIDPi--------LGQKLQEASLFAEIDPYRAATHNKGVMNGIDPVLIATGNDWRAVEAGIHSYAARSGQYkaITRWRY 306 Legionella pneu...
ZP_04645262  209 ASLTKtkdekigekIAQKIVLLSKIGQEDPYRAVTNNKGIMNGVDAILLATGNDFRAVEAACHQAASLSGSYqsLSNWRI 288 Lactobacillus j...
Feature 1                                                                                #       
1QAX_A       310 DnNGHLVGTLEMPMPVGLVGGATKTHPLAQLSLRILGVK-TAQALAEIAVAVGLAQNLGAMRALATEGIQRGHMALHARN 388 Pseudomonas mev...
1QAY_A       310 DnNGHLVGTLEMPMPVGLVGGATKTHPLAQLSLRILGVK-TAQALAEIAVAVGLAQNLGAMRALATEGIQRGHMALHARN 388 Pseudomonas mev...
ZP_01201660  362 E-NDVFTFEADFPLALGTVGGLTSLHPLSKLAMQILENP-SAQDLMKVTAVCGLAQNFAALHSLVTTGIQAGHMKMHLVN 439 Flavobacteria b...
ZP_04057923  314 K-EDIFHFSIEIPLAIGTVGGLTKLHPMVKTALQILENP-SAETLMKVIACVGLAQNFAAVSSLVTYGIQKGHMKMHLAN 391 Capnocytophaga ...
YP_003141153 318 E-GDTFFFALELPLALGTVGGLTTLHPLVKTALEILEKP-NARELMQIVACVGLAQNFSAVSSLISLGIQKGHMKMHLNN 395 Capnocytophaga ...
YP_812849    291 A-GEKLLGQVTLPLALGVVGGSISSRPDIRQSYAILGKI-KAAELAELTASVALANNFAALSAISTKGIQAGHMRLQSRN 368 Lactobacillus d...
YP_001577104 284 Q-DGKLVGELTLPMAIGVVGGSIKARKDVQQSFAILGKEiNSAKLAEIIVSVGLANNLAALLAISTVGIQAGHMKLQARN 362 Lactobacillus h...
NP_968510    305 E-GKSLVGVFEAPLVVGTVGGVTTLHPTAMLSMKMLDTK-SANELSRIVAAVGLVQNLGALKALTTVGIIEGHMKLHTKN 382 Bdellovibrio ba...
YP_001250833 307 Q-NEILTGELTAPIIVGTVGGVTSLHPTAKMCLRMMDIT-SANQLSQVIAAVGLVQNLGALKALCTDGIIQGHMKLHIDN 384 Legionella pneu...
ZP_04645262  289 E-DNKLVGEIKLPLAIGVVGGSIKSRSDVQVAYRILRQV-TASELAEIIAAVGLANNLAALLAISTVGIQKGHMSLQIRN 366 Lactobacillus j...
Feature 1                                                  
1QAX_A       389 IAVVAGARGDEVDWVARQLVey----hdVRADRAVALLKQKR 426 Pseudomonas mevalonii
1QAY_A       389 IAVVAGARGDEVDWVARQLVey----hdVRADRAVALLKQKR 426 Pseudomonas mevalonii
ZP_01201660  440 MLEQIGANDDEKLLLKKAFQdk-----tPSFSGLREMLADIR 476 Flavobacteria bacterium BBFL7
ZP_04057923  392 ILNQLGATPAQKQEIIAYFKdk-----tVSHSEVVQAFNKVA 428 Capnocytophaga gingivalis JCVIHMP016
YP_003141153 396 IFNQLGATEEEKRVLSSYFKdk-----tVTYNDVAEALKKIR 432 Capnocytophaga ochracea DSM 7271
YP_812849    369 VVQTLPASAEEKAAVYQMMIsq----gkYGETAAKNFLKELR 406 Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
YP_001577104 363 IVSELDASDEEKKKVLAQIIkq----kdYSESYAQAVLKQIR 400 Lactobacillus helveticus DPC 4571
NP_968510    383 LALGAGAEEKEIPLVQKKLEeilairkrISLSNAIDVLKELR 424 Bdellovibrio bacteriovorus HD100
YP_001250833 385 LLLVAGANENEMPVLKEKLQewlnlnkrVSLNNAYDLLAEIR 426 Legionella pneumophila str. Corby
ZP_04645262  367 VLKNLTATDEEKNSVKELMQkq----krYSETDAKKFLQEIR 404 Lactobacillus jensenii 269-3

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap