1DQA,1HWK,1HW8


Conserved Protein Domain Family
HMG-CoA_reductase_classI

?
cd00643: HMG-CoA_reductase_classI 
Click on image for an interactive view with Cn3D
Class I hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase (HMGR)
Hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase (HMGR), class I enzyme, homotetramer. Catalyzes the synthesis of coenzyme A and mevalonate in isoprenoid synthesis. In mammals this is the rate limiting committed step in cholesterol biosynthesis. Class I enzymes are found predominantly in eukaryotes and contain N-terminal membrane regions. With the exception of Archaeoglobus fulgidus, most archeae are assigned to class I, based on sequence similarity of the active site, even though they lack membrane regions. Yeast and human HMGR are divergent in their N-terminal regions, but are conserved in their active site. In contrast, human and bacterial HMGR differ in their active site architecture.
Statistics
?
PSSM-Id: 153081
View PSSM: cd00643
Aligned: 55 rows
Threshold Bit Score: 392.301
Threshold Setting Gi: 134101991
Created: 6-Mar-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:catalytic residues [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
1DQA_A        44 AEIIQLVNAKHi-------pAYKLETLie---tHERGVSIRRQLLskk--lsePSSLQYLPyr-dYNYSLVMGA-CCENV 109 human
ZP_01694917   16 EKVKSIEAYTQqiapltqeeIDKLDRKsf--ngSATTEGLEARLSfla---eqGVSVDRLTshsgLESPESLKG-NIENF 89  Microscilla mar...
XP_001826862   9 ESLLYHTSAPLt-------sLGRVFPYml---pAYYFVRLRYFMNmt----riPQAITSKFqtsrASDGETSSV-KIENC 73  Aspergillus ory...
XP_001393640   4 NQIIRTGLSKI---------SAKVNLDr-----GNMVRSIHNDQKtka---qfSQVLTGIEhi-tRHNQDPFKV-KIENF 64  Aspergillus nig...
NP_931673     33 SHDTFSLKHQEa-------tQVELLPRrhlytyTEKARQKRLDYLak----htGHTLKHVAd--tHLDATQLTK-TIEGF 98  Photorhabdus lu...
EEX31988      26 SEQLEQLMSPHf-------eRPALRLTpn--pyISEKNLAKRWDKlspl-tdrDALLDPVT----EQQAELYNK-NIEHF 90  Vibrio corallii...
ZP_00958771   21 DRTPQQMSPKGe-------gFLPLRPSrta-dsKTVARFWEHLKPka----seADQAEIADpa-tVAASETYSA-NIENF 86  Roseovarius nub...
ZP_01688096  115 LQVDDAISNKDng------dTVKIPRDdld-dySEKAIKTRQEFIek----ytSKKLNHTKn---YSFDPHMLAgNCEHF 180 Microscilla mar...
ZP_04500916   22 EEIEKRLSKKD---------GIKYEDIkf---gYDSGSFAERLKLlnlt-edqEKIITGGNs---TEDLETYGL-SIENY 84  Sebaldella term...
ZP_04778769   46 GNIIHSIKNRR---------PAELTVDctl-plSAEVNREGMLQRhsflqkitGKQFPFLSge-eIGEPDRLNG-NIENY 113 Sphingobacteriu...
Feature 1                                         #                                              
1DQA_A       110 IGYMPIPVGVAGPLCLD-----EKEFQVPMATTEGCLVASTNRGCRAIGLGgGASSRVLADGMTRGPVVRLPRAcDSAEV 184 human
ZP_01694917   90 IGMAQVPVGLAGPLLVKgs-eaQGDFFVPLATTEGALIASYNRGMKACRLSgGITSVCLIEGVQRSPFFKFDNLgTVGLF 168 Microscilla mar...
XP_001826862  74 VGFTRVPLGVAGPLQVQgsdgtTGSFYGPLATCEATLIASCSRGCKALNMCqGVRFKILHDSMSRAPAFWFANTeDAVAF 153 Aspergillus ory...
XP_001393640  65 IGYTHVPVGLAGPLHIRtptgpDKEIWAPMATTEAAVVASCCRGCKAANASgGIEVHMGEEGMTRCPVFQFQNPrDALRF 144 Aspergillus nig...
NP_931673     99 IGSIEIPVGIAGPILIKgq-yaQGVYYAPLATTEGALIASISRGSSAIMQSgGTTARVLGQRMIRAPRFEFCSVsHSIMF 177 Photorhabdus lu...
EEX31988      91 IGTVKLPVGLAGPLRVNgl-haNGDYFVPLATTEAALVASYNRGSQLITAAgGASAMLLNEGVTRTPVFEFQHLaDAGQF 169 Vibrio corallii...
ZP_00958771   87 IGTVKVPVGLVGPLRLNgm-naNGDFYVPLATTEAALVASYARGAFAAGRAgGVSTAVLYEGVLRTPAFVFQSLlQAGQF 165 Roseovarius nub...
ZP_01688096  181 AGVAQVPLGFAGPLKVNge-haKGEFLIPLATAEGTLVASYNRGMSVINMSgGVKCTIIGDAMQRAPVFIFEDArGARDF 259 Microscilla mar...
ZP_04500916   85 IGTAKIPVGVAGPIIINgs-yaQGKFYVPMATTEAAMLASYTRGSQLISEVgGCSAFVLSEGVSRCPCFLFKNMlEVGKF 163 Sebaldella term...
ZP_04778769  114 IGMSCVPTGVIGPLRIIgs-aaNADFYVPLATSEGALLASYHRGARACFVAgGITSICLIEGVQRSPLFKFENVgELGLF 192 Sphingobacteriu...
Feature 1                                                                                        
1DQA_A       185 KAWLETseGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPe-----MQI 259 human
ZP_01694917  169 IKWVYQ--RMDKFTEIVESTSRFAKLNDLKANIEGNSVILTFEYLTGDAAGQNMVTICTDKICKYILANFDi----tPLE 242 Microscilla mar...
XP_001826862 154 FDLVPS--LQPKFKKDAESTSKHIRLRTVIPHIVGSSVHVRFEYLCGDAAGQNMVTIATQRVCDRFSASAEaha-lrLQR 230 Aspergillus ory...
XP_001393640 145 ARALPT--LQASFKEVAESTSKHARLQSLTPHTIGRSVHLLFNYTCGDASGQNMVTIATDRVCAWVSKNLEke--ykIVD 220 Aspergillus nig...
NP_931673    178 SDWINE--HISELRYEIGRHSKHAQLVEVKPQIIGRSVHLQFIYNTAAAAGQNMTTICTWYACQWIQQQLAkmafipLRH 255 Photorhabdus lu...
EEX31988     170 VAWVVT--QYDHFKQVAESTTSHGQLHDININIEGNHAYLIFEFHTGDASGQNMVTIATNEVFNYILDHSPi----sPQD 243 Vibrio corallii...
ZP_00958771  166 VDWVVG--NVEALQAVAEATTRHGKLVSLEPFIDTNIVFLICRYTTGDAAGQNMVTIATDALCRAIAKDCPv----pIES 239 Roseovarius nub...
ZP_01688096  260 VKWVHA--HEKTIAYHAETTSSVAKLQDIDHYLSNKFAFLRFNYFTGDAAGQNMVGRATFAACSWILDNYKdn---kIEK 334 Microscilla mar...
ZP_04500916  164 LLWLSE--NEEEVVSHAESTSRYARVRDMNVTVEGNRVYLNIIYTTGDASGQNMVTIATEKACEFIEKNSVi----kPEK 237 Sebaldella term...
ZP_04778769  193 VSWLLP--QEEKLKEITKQTSRFARLTCIQIQIEGNHLIVTFEYQTGDAAGQNMVTICTDTICQYLIAHSPv----kPKL 266 Sphingobacteriu...
Feature 1                  #                                                                     
1DQA_A       260 LAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREvLKTTTEAMIEVNI---NKNLVGSAMagsigGYNAHAANIV 336 human
ZP_01694917  243 WYIEGNYSGDKKATTLSFVNVRGKKVTAEIVIPRFVVDKvLKTTPEKIAQYWQs-sTLGVIQSGAi----GAQGHVANGL 317 Microscilla mar...
XP_001826862 231 ITTDNQMSSDKKLAWGNIIRTRGVRVLVWGSVSNDVSKRvLGCSTELLYQSILnskEGAAMNGQL-----GYSVNPSNVI 305 Aspergillus ory...
XP_001393640 221 TFVEGMLSSDKKPSWRNVTVVRGVETVAWTALSESACQRiLGCSSAKLYDLIQi-tQDAAIRNGEh----GSNMDSANIL 295 Aspergillus nig...
NP_931673    256 FIIDGNTSGDKKVSYQSFIEGRGTRVVAEVYLEAESCQQiLRVTPQQLVTAYHh-vCEGAIASGMv----GININAANVI 330 Photorhabdus lu...
EEX31988     244 AFLDGNLSGDKKPNAHTLRHVRGKKVTAEIQLTRELVEKyLHTTPEQMVKFGQmttTGAALSGSI-----GVNAHYANAL 318 Vibrio corallii...
ZP_00958771  240 WYIEGNFSGDKKASALAMVTGRGRKVSASITLPAGVVEKtLGTSVEAMLAYGRvanLGAHLSGQL-----GAQAHYANGL 314 Roseovarius nub...
ZP_01688096  335 FFLESNFATDKKASQINVMRTRGKRVVAECVVKRDVLIQrMRVEPEQLAYHGQvanIGAILSGAN-----NNGLHSANAI 409 Microscilla mar...
ZP_04500916  238 WYIEANMSGDKKASSQSFQSVRGKKVVCEVIIPKELLKKrLNVTAREMEKFYQv-tQNGGIQSGVf----GNQGHYANAL 312 Sebaldella term...
ZP_04778769  267 WFVEGNYSGDKKATALSFTNVRGKKVTAEIVLPETIVQQvLKTTPELMAEYWRs-sTMGIIQSGAi----GAHGHYANGL 341 Sphingobacteriu...
Feature 1                 #                                                                      
1DQA_A       337 TAIYIACGQDAAQNVGSSNCITLMEASgptNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGackdnpgenARQ 416 human
ZP_01694917  318 TALFIACGQDVACISESSIGLTRMETNt--DGDLYVSVTLPSLIVGTVGGGTSLATQKECLEMLGCAGan------kAKK 389 Microscilla mar...
XP_001826862 306 AAMFIACGQDAASVAEAAWSQLTAEYDa-dTKLLRLISYFPSLPVGVVGGGTAYPTQRESLEILGCNVpg------tKHR 378 Aspergillus ory...
XP_001393640 296 AAIFIATGQDAACVADASWAHLTPEYDq-mSKTLTLSLYFPSMPVGVIGGGTSYATQQEGLRIMQCSEpg------gKRR 368 Aspergillus nig...
NP_931673    331 AGMFTALGQDIACVHESSVAHLHMTLTa--DNRVYCSITLPSLIVGTIGGGTNLPHQRECLNMLGCTDen------gTAR 402 Photorhabdus lu...
EEX31988     319 AALYIACGQDAACVSESAIGITRMELNk--QGGLYACVTLPNLMVGTVGGGTHLPSQKACLELMGLLGtg------kAKA 390 Vibrio corallii...
ZP_00958771  315 AAFYIATGQDAACVAESAVGVTRMEPR---GEDLFCSVTLPNILVGSVGGGTGLPSQSAALNILGLKGag------hGTA 385 Roseovarius nub...
ZP_01688096  410 TAMFIATGQDVANVSESSAGIIYSEVTa--EGDLYISITIPSLIVATYGGGTGLATQKECLELLDCYGkg------kVNK 481 Microscilla mar...
ZP_04500916  313 AGIYIACGQDAACVSESSVGLTRFEALe--DESLYASVTLPNLMVGTVGGGTGLPTQKIYLEVLGAYGtg------nANK 384 Sebaldella term...
ZP_04778769  342 AALFLATGQDVACVAEAATGITRMELNk--DGSLYASVTLPNLMVGTVGGGTHLSTQRECLEIMDCYGag------qARK 413 Sphingobacteriu...
Feature 1                                    #     
1DQA_A       417 LARIVCGTVMAGELSLMAALAAGHLVKSHMIHNR 450 human
ZP_01694917  390 FAEICCAVALAGEISIASAMSADHFTNAHQKLGR 423 Microscilla marina ATCC 23134
XP_001826862 379 LAGLIASFSLALDISTLAALATQTFSRSHEKLAR 412 Aspergillus oryzae RIB40
XP_001393640 369 LAGYIAAFALALEISTASAVVTKTFARSHEQLAR 402 Aspergillus niger CBS 513.88
NP_931673    403 LAEIIASYCLALDISTLSAVAADEFAQSHEKLGR 436 Photorhabdus luminescens subsp. laumondii TTO1
EEX31988     391 LAEVAAVLCLAGELSIVGAFCAGHFSRAHQKLAR 424 Vibrio coralliilyticus ATCC BAA-450
ZP_00958771  386 LAEVAAALCLCGEISIVAAIAAGHFTRAHESLAR 419 Roseovarius nubinhibens ISM
ZP_01688096  482 FAEIVAGAVLAGEISLASAISSSDWVSSHEQYGR 515 Microscilla marina ATCC 23134
ZP_04500916  385 FAEIVAGMCLAGELSISAAICSNNFTRAHKIFSR 418 Sebaldella termitidis ATCC 33386
ZP_04778769  414 FAEICGGLVLAGELSIAAALSAGHFTSAHQKFGR 447 Sphingobacterium spiritivorum ATCC 33861

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap