Conserved Protein Domain Family

cd00643: HMG-CoA_reductase_classI 
Click on image for an interactive view with Cn3D
Class I hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase (HMGR)
Hydroxymethylglutaryl-coenzyme A (HMG-CoA) reductase (HMGR), class I enzyme, homotetramer. Catalyzes the synthesis of coenzyme A and mevalonate in isoprenoid synthesis. In mammals this is the rate limiting committed step in cholesterol biosynthesis. Class I enzymes are found predominantly in eukaryotes and contain N-terminal membrane regions. With the exception of Archaeoglobus fulgidus, most archeae are assigned to class I, based on sequence similarity of the active site, even though they lack membrane regions. Yeast and human HMGR are divergent in their N-terminal regions, but are conserved in their active site. In contrast, human and bacterial HMGR differ in their active site architecture.
PSSM-Id: 153081
Aligned: 55 rows
Threshold Bit Score: 392.301
Threshold Setting Gi: 134101991
Created: 6-Mar-2002
Updated: 2-Oct-2020
Aligned Rows:
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:catalytic residues [active site]

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1                                                                                        
ZP_01694917   16 EKVKSIEAYTQqiapltqeeIDKLDRKsf--ngSATTEGLEARLSfla---eqGVSVDRLTshsgLESPESLKG-NIENF 89  Microscilla mar...
XP_001826862   9 ESLLYHTSAPLt-------sLGRVFPYml---pAYYFVRLRYFMNmt----riPQAITSKFqtsrASDGETSSV-KIENC 73  Aspergillus ory...
XP_001393640   4 NQIIRTGLSKI---------SAKVNLDr-----GNMVRSIHNDQKtka---qfSQVLTGIEhi-tRHNQDPFKV-KIENF 64  Aspergillus nig...
NP_931673     33 SHDTFSLKHQEa-------tQVELLPRrhlytyTEKARQKRLDYLak----htGHTLKHVAd--tHLDATQLTK-TIEGF 98  Photorhabdus lu...
EEX31988      26 SEQLEQLMSPHf-------eRPALRLTpn--pyISEKNLAKRWDKlspl-tdrDALLDPVT----EQQAELYNK-NIEHF 90  Vibrio corallii...
ZP_00958771   21 DRTPQQMSPKGe-------gFLPLRPSrta-dsKTVARFWEHLKPka----seADQAEIADpa-tVAASETYSA-NIENF 86  Roseovarius nub...
ZP_01688096  115 LQVDDAISNKDng------dTVKIPRDdld-dySEKAIKTRQEFIek----ytSKKLNHTKn---YSFDPHMLAgNCEHF 180 Microscilla mar...
ZP_04500916   22 EEIEKRLSKKD---------GIKYEDIkf---gYDSGSFAERLKLlnlt-edqEKIITGGNs---TEDLETYGL-SIENY 84  Sebaldella term...
ZP_04778769   46 GNIIHSIKNRR---------PAELTVDctl-plSAEVNREGMLQRhsflqkitGKQFPFLSge-eIGEPDRLNG-NIENY 113 Sphingobacteriu...
Feature 1                                         #                                              
Feature 1                                                                                        
Feature 1                  #                                                                     
Feature 1                 #                                                                      
Feature 1                                    #     
ZP_01694917  390 FAEICCAVALAGEISIASAMSADHFTNAHQKLGR 423 Microscilla marina ATCC 23134
XP_001826862 379 LAGLIASFSLALDISTLAALATQTFSRSHEKLAR 412 Aspergillus oryzae RIB40
XP_001393640 369 LAGYIAAFALALEISTASAVVTKTFARSHEQLAR 402 Aspergillus niger CBS 513.88
NP_931673    403 LAEIIASYCLALDISTLSAVAADEFAQSHEKLGR 436 Photorhabdus luminescens subsp. laumondii TTO1
EEX31988     391 LAEVAAVLCLAGELSIVGAFCAGHFSRAHQKLAR 424 Vibrio coralliilyticus ATCC BAA-450
ZP_00958771  386 LAEVAAALCLCGEISIVAAIAAGHFTRAHESLAR 419 Roseovarius nubinhibens ISM
ZP_01688096  482 FAEIVAGAVLAGEISLASAISSSDWVSSHEQYGR 515 Microscilla marina ATCC 23134
ZP_04500916  385 FAEIVAGMCLAGELSISAAICSNNFTRAHKIFSR 418 Sebaldella termitidis ATCC 33386
ZP_04778769  414 FAEICGGLVLAGELSIAAALSAGHFTSAHQKFGR 447 Sphingobacterium spiritivorum ATCC 33861

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap