
Conserved Protein Domain Family

cd00640: Trp-synth-beta_II 
Click on image for an interactive view with Cn3D
Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions. This CD corresponds to aminocyclopropane-1-carboxylate deaminase (ACCD), tryptophan synthase beta chain (Trp-synth_B), cystathionine beta-synthase (CBS), O-acetylserine sulfhydrylase (CS), serine dehydratase (Ser-dehyd), threonine dehydratase (Thr-dehyd), diaminopropionate ammonia lyase (DAL), and threonine synthase (Thr-synth). ACCD catalyzes the conversion of 1-aminocyclopropane-1-carboxylate to alpha-ketobutyrate and ammonia. Tryptophan synthase folds into a tetramer, where the beta chain is the catalytic PLP-binding subunit and catalyzes the formation of L-tryptophan from indole and L-serine. CBS is a tetrameric hemeprotein that catalyzes condensation of serine and homocysteine to cystathionine. CS is a homodimer that catalyzes the formation of L-cysteine from O-acetyl-L-serine. Ser-dehyd catalyzes the conversion of L- or D-serine to pyruvate and ammonia. Thr-dehyd is active as a homodimer and catalyzes the conversion of L-threonine to 2-oxobutanoate and ammonia. DAL is also a homodimer and catalyzes the alpha, beta-elimination reaction of both L- and D-alpha, beta-diaminopropionate to form pyruvate and ammonia. Thr-synth catalyzes the formation of threonine and inorganic phosphate from O-phosphohomoserine.
PSSM-Id: 107202
Aligned: 318 rows
Threshold Bit Score: 79.0961
Threshold Setting Gi: 42527695
Created: 1-Aug-2008
Updated: 2-Oct-2020
Aligned Rows:
Conserved site include 1 residue -Click on image for an interactive view with Cn3D
Feature 1:catalytic residue [active site]
  • Comment:pyridoxal 5'-phosphate (PLP) forms an internal aldimine bond (Schiff base linkage) with the catalytic residue lysine
  • Structure:1KL7_A; catalytic residue (lys) and cofactor (PLP)
    View structure with Cn3D

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1                                   #                                                 
1BEU_B     57 TALTKcqnitagtrttLYLKREDLLHgGAHKTNQVLGQALLAKrmg-------------kseIIAETgagQHGVASALAS 123 Salmonella typhimu...
1KL7_A     97 TPLVQnvtg---dkenLHILELFHGPtYAFKDVALQFVGNLFEyflqrtnanlpegekkqitVVGATs-gDTGSAAIYGL 172 baker's yeast
Q5XH07     90 VPITRlk-------sgLNVMEMWHGVtHAFKDLAMSCVGELLDyflkrk--------nkhvtILVATs-gDTGSSAIESV 153 African clawed frog
Q86YJ6     90 VHLSRlr-------ngLNVLELWHGVtYAFKDLSLSCTTQFLQyflekr--------ekhvtVVVGTs-gDTGSAAIESV 153 human
Q2YDP8     90 VRLVQlk-------dsLSILELFHGEtLAFKDLAMSCTAHFLQyflrrd--------rqratILVGTs-gDTGSSAIRSV 153 zebrafish
NP_347635  91 APIKKag--------dTYFLELYHGPtLAFKDMALSILPYLLKtaskkng------iqdkivILTATs-gDTGKAALEGF 155 Clostridium acetob...
NP_720550  90 APLVKln--------gQYNLELFHGStIAFKDMALSILPYLLTtsakkqg------innkivILTATs-gDTGKAAMAGF 154 Streptococcus muta...
NP_782895  92 VPIVKke--------dVYFLELYHGPtLAFKDMALSILPYLLKaslkknk------iekevvILTATs-gDTGKAALEGF 156 Clostridium tetani...
NP_696205  90 TPLKPlg--------dDYVLELFNGPtSAFKDVALQILPRFMAhttpadg-----dadekimILTATs-gDTGKAALAGF 155 Bifidobacterium lo...
Q8IYQ7    328 APVRHls-------gnQFILELFHGPtGSFKDLSLQLMPHIFAhcipp---------scnymILVATs-gDTGSAVLNGF 390 human
1KL7_A     97 TPLVQnvtg---dkenLHILELFHGPtYAFKDVALQFVGNLFEyflqrtnanlpegekkqitVVGATs-gDTGSAAIYGL 172 baker's yeast
Q5XH07     90 VPITRlk-------sgLNVMEMWHGVtHAFKDLAMSCVGELLDyflkrk--------nkhvtILVATs-gDTGSSAIESV 153 African clawed frog
Q86YJ6     90 VHLSRlr-------ngLNVLELWHGVtYAFKDLSLSCTTQFLQyflekr--------ekhvtVVVGTs-gDTGSAAIESV 153 human
Q2YDP8     90 VRLVQlk-------dsLSILELFHGEtLAFKDLAMSCTAHFLQyflrrd--------rqratILVGTs-gDTGSSAIRSV 153 zebrafish
NP_347635  91 APIKKag--------dTYFLELYHGPtLAFKDMALSILPYLLKtaskkng------iqdkivILTATs-gDTGKAALEGF 155 Clostridium acetob...
NP_720550  90 APLVKln--------gQYNLELFHGStIAFKDMALSILPYLLTtsakkqg------innkivILTATs-gDTGKAAMAGF 154 Streptococcus muta...
NP_782895  92 VPIVKke--------dVYFLELYHGPtLAFKDMALSILPYLLKaslkknk------iekevvILTATs-gDTGKAALEGF 156 Clostridium tetani...
NP_696205  90 TPLKPlg--------dDYVLELFNGPtSAFKDVALQILPRFMAhttpadg-----dadekimILTATs-gDTGKAALAGF 155 Bifidobacterium lo...
Q8IYQ7    328 APVRHls-------gnQFILELFHGPtGSFKDLSLQLMPHIFAhcipp---------scnymILVATs-gDTGSAVLNGF 390 human
Feature 1                                                                                     
1BEU_B    124 al------lgLKCRIYMGakdverqsPNVFRMRLMg---aEVIPVhsgsatlkdACNEALRDWsgs----------yetA 184 Salmonella typhimu...
1KL7_A    173 rgk-----kdVSVFILYPtgr--ispIQEEQXTTVpdenvQTLSVtgt---fdnCQDIVKAIFgdkef------nskhnV 236 baker's yeast
Q5XH07    154 rrr-----enMDIIVLLPhgr--ctkIQELQMTTViednvHVFSVdgt---sdeLDYPIKRLFadsdf------vkkhnI 217 African clawed frog
Q86YJ6    154 qga-----knMDIIVLLPkgh--ctkIQELQMTTVlkqnvHVFGVegn---sdeLDEPIKTVFadvaf------vkkhnL 217 human
Q2YDP8    154 lgl-----reVDIVVVFPrgr--itkIQELQMTTSvaenvHVFAAdgt---sddIDVPLRKLFadadl------vqrhrL 217 zebrafish
NP_347635 156 kdv-----egTEIIVFFPndg--vseVQRLQMVTQkgkntHVVAIrgn---fddAQSGVKKIFtdkefiqe-lkenncvF 224 Clostridium acetob...
NP_720550 155 adv-----pgTEIIVFYPngg--vskIQELQMTTQvgdntHVVAIegn---fddAQTNVKKMFndsdlrtk-llehgaqF 223 Streptococcus muta...
NP_782895 157 adv-----ddTKIIVFYPehg--vspIQKKQMSTQkgentYVIGVngn---fdeAQNSIKEIFndevlees-iekkgyiF 225 Clostridium tetani...
NP_696205 156 ada-----pgTAITVFYPegk--vsqVQELQMTTQagsnvQVAAVegn---fddAQSAVKRIFgdralaerlagnshvvL 225 Bifidobacterium lo...
Q8IYQ7    391 srlnkndkqrIAVVAFFPeng--vsdFQKAQIIGSqrengWAVGVesd---fdfCQTAIKRIFndsdftgfltveygtiL 465 human
1KL7_A    173 rgk-----kdVSVFILYPtgr--ispIQEEQXTTVpdenvQTLSVtgt---fdnCQDIVKAIFgdkef------nskhnV 236 baker's yeast
Q5XH07    154 rrr-----enMDIIVLLPhgr--ctkIQELQMTTViednvHVFSVdgt---sdeLDYPIKRLFadsdf------vkkhnI 217 African clawed frog
Q86YJ6    154 qga-----knMDIIVLLPkgh--ctkIQELQMTTVlkqnvHVFGVegn---sdeLDEPIKTVFadvaf------vkkhnL 217 human
Q2YDP8    154 lgl-----reVDIVVVFPrgr--itkIQELQMTTSvaenvHVFAAdgt---sddIDVPLRKLFadadl------vqrhrL 217 zebrafish
NP_347635 156 kdv-----egTEIIVFFPndg--vseVQRLQMVTQkgkntHVVAIrgn---fddAQSGVKKIFtdkefiqe-lkenncvF 224 Clostridium acetob...
NP_720550 155 adv-----pgTEIIVFYPngg--vskIQELQMTTQvgdntHVVAIegn---fddAQTNVKKMFndsdlrtk-llehgaqF 223 Streptococcus muta...
NP_782895 157 adv-----ddTKIIVFYPehg--vspIQKKQMSTQkgentYVIGVngn---fdeAQNSIKEIFndevlees-iekkgyiF 225 Clostridium tetani...
NP_696205 156 ada-----pgTAITVFYPegk--vsqVQELQMTTQagsnvQVAAVegn---fddAQSAVKRIFgdralaerlagnshvvL 225 Bifidobacterium lo...
Q8IYQ7    391 srlnkndkqrIAVVAFFPeng--vsdFQKAQIIGSqrengWAVGVesd---fdfCQTAIKRIFndsdftgfltveygtiL 465 human
Feature 1                                                                                     
1BEU_B    185 HYMlgtaagphpypTIVREFQRMIGEETKAQIldke----grlpDAVIACVGGGSNAIGMFADFINdt-svGLIGVEPgg 259 Salmonella typhimu...
1KL7_A    237 GAVns-------inWARILAQXTYYFYSFFQAtngk----dskkVKFVVPSGNFGDILAGYFAKKXglpieKLAIATNen 305 baker's yeast
Q5XH07    218 MSTns-------vnWARILVQIAHFFYGYMQCaplt----eltpVEIIVPTGGAGNITAGCIAQAMglpihLVAVVNRnd 286 African clawed frog
Q2YDP8    218 MSLns-------vnWSRIMVQTAHFLFAYLQLtpslpegdtlpvLEVLVPTGGAGNITAGIIVKRMgvplrLVAMVNAnd 290 zebrafish
NP_347635 225 SSAns-------inIGRLVPQIVYYFYAYSKMcskgei-nfgekINFVVPTGNFGNILAAYFAKSMgvpinKLICASNdn 296 Clostridium acetob...
NP_720550 224 SSAns-------mnVGRLVPQVVYYVYAYAQLlksgdi-kngdrVNFTVPTGNFGNILAAYYARQIgvpigKLICASNen 295 Streptococcus muta...
NP_782895 226 SSAns-------inIGRLIPQIVYYVYSYMWLlkkgei-eegeeINIVVPTGNFGNILAAYYSKKMgipvnKFICASNen 297 Clostridium tetani...
NP_696205 226 SSAns-------inVGRLVPQVVYYFSAYAQLladqvi-nvgdeVEFVVPTGNFGDILAGYYAKLLglpvkHLVVASDkn 297 Bifidobacterium lo...
1KL7_A    237 GAVns-------inWARILAQXTYYFYSFFQAtngk----dskkVKFVVPSGNFGDILAGYFAKKXglpieKLAIATNen 305 baker's yeast
Q5XH07    218 MSTns-------vnWARILVQIAHFFYGYMQCaplt----eltpVEIIVPTGGAGNITAGCIAQAMglpihLVAVVNRnd 286 African clawed frog
Q2YDP8    218 MSLns-------vnWSRIMVQTAHFLFAYLQLtpslpegdtlpvLEVLVPTGGAGNITAGIIVKRMgvplrLVAMVNAnd 290 zebrafish
NP_347635 225 SSAns-------inIGRLVPQIVYYFYAYSKMcskgei-nfgekINFVVPTGNFGNILAAYFAKSMgvpinKLICASNdn 296 Clostridium acetob...
NP_720550 224 SSAns-------mnVGRLVPQVVYYVYAYAQLlksgdi-kngdrVNFTVPTGNFGNILAAYYARQIgvpigKLICASNen 295 Streptococcus muta...
NP_782895 226 SSAns-------inIGRLIPQIVYYVYSYMWLlkkgei-eegeeINIVVPTGNFGNILAAYYSKKMgipvnKFICASNen 297 Clostridium tetani...
NP_696205 226 SSAns-------inVGRLVPQVVYYFSAYAQLladqvi-nvgdeVEFVVPTGNFGDILAGYYAKLLglpvkHLVVASDkn 297 Bifidobacterium lo...
Feature 1                                                                                     
1BEU_B    260 hgietgehgaplkhgrvgiyfgmkapmmqta----------------------dgqieesysisagldfpsvgpqhayln 317 Salmonella typhimu...
1KL7_A    306 dildrflksglyersdkvaatlspaxdilissnferllwylareylangddlkageivnnwfqelktngkfqvdksiieg 385 baker's yeast
Q5XH07    287 ivhrtvqygdfslgdtkatlasamdiqepynmeril-----------wllagsekshikemmkefqekkrvklpeqlhkk 355 African clawed frog
Q86YJ6    290 iihrtvqqgdfslseavkstlasamdiqvpynmervf----------wllsgsdsqvtralmeqfertqsvnlpkelhsk 359 human
Q2YDP8    291 ivhrtvqsgdfsmsssvtqtlapaidiqdpynmervf----------wllsggdglmvkslmeefqkthklslpaslhqq 360 zebrafish
NP_347635 297 kvlydffengtydrnrefvttispsmdilissnlerl----------iylvcdrdsskvadfmrelseggkynitenmkk 366 Clostridium acetob...
NP_720550 296 nvltdffktgtydkkrefrvttspsmdilvssnlerl----------ifhllgndsvktkelmqaliekgeytlekadka 365 Streptococcus muta...
NP_782895 298 nvlceffnkgiydknkefkitsspsmdilissnlerl----------iyeicdgnedkvktymdklkyggtyeldkeele 367 Clostridium tetani...
NP_696205 298 nvlfdflttgtynrqrpffqtispsmdilissnlerm---------lyylsegdtrlismlmndlnkwgtyeipeellak 368 Bifidobacterium lo...
Q8IYQ7    538 hvltdfiktghydlrerklaqtfspsidilkssnlerh--------lhlmankdgqlmtelfnrlesqhhfqiekalvek 609 human
1KL7_A    306 dildrflksglyersdkvaatlspaxdilissnferllwylareylangddlkageivnnwfqelktngkfqvdksiieg 385 baker's yeast
Q5XH07    287 ivhrtvqygdfslgdtkatlasamdiqepynmeril-----------wllagsekshikemmkefqekkrvklpeqlhkk 355 African clawed frog
Q86YJ6    290 iihrtvqqgdfslseavkstlasamdiqvpynmervf----------wllsgsdsqvtralmeqfertqsvnlpkelhsk 359 human
Q2YDP8    291 ivhrtvqsgdfsmsssvtqtlapaidiqdpynmervf----------wllsggdglmvkslmeefqkthklslpaslhqq 360 zebrafish
NP_347635 297 kvlydffengtydrnrefvttispsmdilissnlerl----------iylvcdrdsskvadfmrelseggkynitenmkk 366 Clostridium acetob...
NP_720550 296 nvltdffktgtydkkrefrvttspsmdilvssnlerl----------ifhllgndsvktkelmqaliekgeytlekadka 365 Streptococcus muta...
NP_782895 298 nvlceffnkgiydknkefkitsspsmdilissnlerl----------iyeicdgnedkvktymdklkyggtyeldkeele 367 Clostridium tetani...
NP_696205 298 nvlfdflttgtynrqrpffqtispsmdilissnlerm---------lyylsegdtrlismlmndlnkwgtyeipeellak 368 Bifidobacterium lo...
Q8IYQ7    538 hvltdfiktghydlrerklaqtfspsidilkssnlerh--------lhlmankdgqlmtelfnrlesqhhfqiekalvek 609 human
Feature 1                                                                       
1BEU_B    318 sigraDYVSITdDEALEAFKTLCrh----egIIPALESSHALAHALKMmreqpekeqLLVVNLSGR 379 Salmonella typhimurium
1KL7_A    386 askdfTSERVSnEETSETIKKIYessvnpkhYILDPHTAVGVCATERLiakdndksiQYISLSTAH 451 baker's yeast
Q5XH07    356 iagamTSCVVTdENILGTIGRCWee----nhYLLCPHSAVAVYYHYQQmdsn--dksPRCCLAPAS 415 African clawed frog
Q2YDP8    361 lsevlSSGSVSdDGILEAMRRCWqd----nhYLICPHTAVAVWRHYQSpvr---pgeSRCCIATAS 419 zebrafish
NP_347635 367 klkdfYAGYATeEETKKAIEKMYke----nkYLIDTHTAVAYSVYEKYlknt-kdkaKTVIASTAS 427 Clostridium acetobutylicum ATCC 824
NP_720550 366 ildlfAAGFATeEETAAEIKRVYta----srYIEDPHTAVASAVYHAYrkss-gdqsPTVIASTAS 426 Streptococcus mutans UA159
NP_782895 368 klnsfYSSFATdEETYEKLKEVYdk----ysYLMDTHTAVAYKVYEDYkkdt-gdkrKSIIASTAS 428 Clostridium tetani E88
NP_696205 369 irqifGTGWADeDQVRESIKHCWde----hhYVIDPHTACGYYLLEQMprd---pltPRVLLSTAS 427 Bifidobacterium longum NCC2705
1KL7_A    386 askdfTSERVSnEETSETIKKIYessvnpkhYILDPHTAVGVCATERLiakdndksiQYISLSTAH 451 baker's yeast
Q5XH07    356 iagamTSCVVTdENILGTIGRCWee----nhYLLCPHSAVAVYYHYQQmdsn--dksPRCCLAPAS 415 African clawed frog
Q2YDP8    361 lsevlSSGSVSdDGILEAMRRCWqd----nhYLICPHTAVAVWRHYQSpvr---pgeSRCCIATAS 419 zebrafish
NP_347635 367 klkdfYAGYATeEETKKAIEKMYke----nkYLIDTHTAVAYSVYEKYlknt-kdkaKTVIASTAS 427 Clostridium acetobutylicum ATCC 824
NP_720550 366 ildlfAAGFATeEETAAEIKRVYta----srYIEDPHTAVASAVYHAYrkss-gdqsPTVIASTAS 426 Streptococcus mutans UA159
NP_782895 368 klnsfYSSFATdEETYEKLKEVYdk----ysYLMDTHTAVAYKVYEDYkkdt-gdkrKSIIASTAS 428 Clostridium tetani E88
NP_696205 369 irqifGTGWADeDQVRESIKHCWde----hhYVIDPHTACGYYLLEQMprd---pltPRVLLSTAS 427 Bifidobacterium longum NCC2705

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap