1H16,1R9E,1HK8,1L1L,4R1R,1XJE,2HA9


Conserved Protein Domain Family
RNR_PFL

?
cd00576: RNR_PFL 
Click on image for an interactive view with Cn3D
Ribonucleotide reductase and Pyruvate formate lyase
Ribonucleotide reductase (RNR) and pyruvate formate lyase (PFL) are believed to have diverged from a common ancestor. They have a structurally similar ten-stranded alpha-beta barrel domain that hosts the active site, and are radical enzymes. RNRs are found in all organisms and provide the only mechanism by which nucleotides are converted to deoxynucleotides. RNRs are separated into three classes based on their metallocofactor usage. Class I RNRs use a diiron-tyrosyl radical while Class II RNRs use coenzyme B12 (adenosylcobalamin, AdoCbl). Class III RNRs use an FeS cluster and S-adenosylmethionine to generate a glycyl radical. PFL, an essential enzyme in anaerobic bacteria, catalyzes the conversion of pyruvate and CoA to acteylCoA and formate in a mechanism that uses a glycyl radical.
Statistics
?
PSSM-Id: 153083
View PSSM: cd00576
Aligned: 8 rows
Threshold Bit Score: 171.947
Threshold Setting Gi: 114794293
Created: 7-Mar-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1H16_A    153 TPDILRCrksgvLTGlpda------------------------------------ygrGRIIGDYRrvalygidylmkdk 196  Escherichia coli
1R9E_A    140 TEETREAvncdvFTVgnyy-----------------------------------yngvGHVSVDYGkvlrvgfngiinea 184  Clostridium butyr...
1HK8_A     51 PSFIMKAhesgiIHVhdidys-------------------------------palpftNCCLVDLKgmlengfklgna-- 97   T4
1L1L_A     82 AERLYKLiyglgATPsgrnlwisgtd----------------------yqrrtgdslnNCWFVAIRpqkygdskivp--- 136  Lactobacillus lei...
4R1R_A    193 VKRFYDAvstfkISLptpimsgv---------------------------rtptrqfsSCVLIECGdsl----------- 234  Escherichia coli
1XJE_A     75 EDIFFRVlkarlFIPnsptlfnaglgvkhdllwkpidqmtledyeeiyrsrnhlhmlsACFVVPVGdsi----------- 143  Thermotoga maritima
CAD15248  607 AERFRWFnlslsPTSg-----------------------------------------vGHVVPGYEallthgirgvsrqi 645  Ralstonia solanac...
2HA9_A     11 IAXIEEQ-----NFDir----------------------------------------tITXGISLLdcidpd-------- 37   Streptococcus pne...
1H16_A    197 laqftslqadlengvnleqtirl---------------------reeiaeqhralgqmkemaakygydisgpatnaqeai 255  Escherichia coli
1R9E_A    185 keqleknrsidpdfikkekflnsviisceaaityvnryakkakeiadntsdakrkaelneiakicskvsgegaksfyeac 264  Clostridium butyr...
1HK8_A     98 --------------------------------------------------------------------qietpksigvat 109  T4
1L1L_A    137 ----------------------------------------------------------------------sylgkqekav 146  Lactobacillus lei...
4R1R_A    235 -----------------------------------------------------------------------------dsi 237  Escherichia coli
1XJE_A    144 -----------------------------------------------------------------------------eei 146  Thermotoga maritima
CAD15248  646 deaqq---------------------------------------------------------alaatdpqraeavapfya 668  Ralstonia solanac...
2HA9_A     38 ---------------------------------------------------------------------------inraa 42   Streptococcus pne...
1H16_A    256 QWTYFGYLAAVKSqn---------------gAAMSFGrtsTFLDvyierdlka--------------------------- 293  Escherichia coli
1R9E_A    265 QLFWFIHAIINIEsn---------------gHSISPArfdQYMYpyyendk----------------------------- 300  Clostridium butyr...
1HK8_A    110 AIMAQITAQVASHq----------------yGGTTFAnvdKVLSpyvkrtyakhiedaekw------------------- 154  T4
1L1L_A    147 SMPFSFLFDELMKg-----------------GGVGFSvarSNISqiprvdfaidlqlvvdetsesydasvkvgavgknel 209  Lactobacillus lei...
4R1R_A    238 NATSSAIVKYVSQr-----------------AGIGINa--GRIRalgspirg---------------------------- 270  Escherichia coli
1XJE_A    147 FEAVKEYALITKVg-----------------GGVGSNf--SELRpkgsfvag---------------------------- 179  Thermotoga maritima
CAD15248  669 GSRLALRGLAEYLeg---------------lAGTAHDtaqALPQdqkiertnlaemearlrrlasgavpetvldalqlvl 733  Ralstonia solanac...
2HA9_A     43 EKIYQKITTKAANlvavgdeiaaelgipivnKRVSVTpisLIGAatda-------------------------------- 90   Streptococcus pne...
1H16_A        --------------------------------------------------------------------------------      Escherichia coli
1R9E_A        --------------------------------------------------------------------------------      Clostridium butyr...
1HK8_A    155 ------------------------------------------------------------------------qiadalny 162  T4
1L1L_A    210 vqdadsiyyrlpdtregwvlanallidlhfaqtnpdrkqklildlsdirpygaeihgfggtasgpmplismlldvnevln 289  Lactobacillus lei...
4R1R_A        --------------------------------------------------------------------------------      Escherichia coli
1XJE_A        --------------------------------------------------------------------------------      Thermotoga maritima
CAD15248  734 -----------------------------------------------------achatlhlcgepvavgrldrlirpfqe 760  Ralstonia solanac...
2HA9_A        --------------------------------------------------------------------------------      Streptococcus pne...
1H16_A    294 -gkiteqeaQEMVDHLVMKLRMvrflrtpeydelfsgdpIWATESIGgmgldgrtlvtknSFRFLNTLYtmg-------- 364  Escherichia coli
1R9E_A    301 --nitdkfaQELIDCIWIKLNDinkvrdeistkhfggypMYQNLIVGgqnsegkdatnkvSYMALEAAVhvk-------- 370  Clostridium butyr...
1HK8_A    163 aqsktekdvYDAFQAYEYEVNTlfss---------ngqtPFVTITFGtgtdw---termiQKAILKNRIkglgrd----- 225  T4
1L1L_A    290 nkaggrltaVDAADICNLIGKAvvag---------nvrrSAELALGSn-----------dDQDFISMKQdqekl------ 343  Lactobacillus lei...
4R1R_A    271 -geafhtgcIPFYKHFQTAVKSasqg---------gvrgGAATLFYPmwh--------leVESLLVLKNnrgve------ 326  Escherichia coli
1XJE_A    180 -thgkasgpVSFMHVFNSAISVvkqg---------srrrGALMGILNinh--------pdIEEFIDAKKentge------ 235  Thermotoga maritima
CAD15248  761 kaplgetqlQEAIDCFWLKLGEk---------------tLLNRIFIDd------------RQELGNLAMgnragpypkgq 813  Ralstonia solanac...
2HA9_A     91 ------tdyVVLAKALDKAAKEig--------------vDFIGGFSAlvqkgy-qkgdeiLINSIPRALae--------- 140  Streptococcus pne...
1H16_A    365 ------------------------------------pspEPNMTILWSEklp---------------------------- 380  Escherichia coli
1R9E_A    371 -------------------------------------lpQPSLSVRIWNktp---------------------------- 385  Clostridium butyr...
1HK8_A    226 ----------------------------------gitpiFPKLVMFVEEgvnlykd------------------------ 247  T4
1L1L_A    344 ----------------------------------mhhrwASNNSVAVDSaf----------------------------- 360  Lactobacillus lei...
4R1R_A    327 ----------------------------------gnrvrHMDYGVQINKlmytrllkgeditlfspsdvpglydaffadq 372  Escherichia coli
1XJE_A    236 -----------------------------------avlnFFNLSVGFPMdkkeilklyeedgelel-------------- 266  Thermotoga maritima
CAD15248  814 svnqwiqqvtvgglnadgsweysdvtlaclrassrlpfnAPVLSLRVSRdmps--------------------------- 866  Ralstonia solanac...
2HA9_A    141 -------------------------------------tdKVCSSVNIGStksgin------------------------- 158  Streptococcus pne...
1H16_A    381 -----------------------lnfKKFAAKVSIDt-----SSLQYENDdlmrpdfnnddya----------------- 415  Escherichia coli
1R9E_A    386 -----------------------defLLRAAELTREg----lGLPAYYNDeviipalvsrgltleda------------- 425  Clostridium butyr...
1HK8_A    248 --------------------dpnydiKQLALECASKr-----MYPDIISAknnkaitgssvpvspmgc------------ 290  T4
1L1L_A    361 ------------------------sgYQPIAAGIREn-----GEPGIVNLdlsknygrivdgyqagid------------ 399  Lactobacillus lei...
4R1R_A    373 eeferlytkyekddsirkqrvkavelFSLMMQERASt-----GRIYIQNVdhcnthspfdpaiapvrqsnl--------- 438  Escherichia coli
1XJE_A    267 ----------shprstirkkvkirelFRKIATNAWKs-----GDPGLAFLgemnkyyplyphrki--------------- 316  Thermotoga maritima
CAD15248  867 -----------------------awrKRLLAEAARGqls-ggASPILLNDdkiipalsssgiaigprasadeaarwnaav 922  Ralstonia solanac...
2HA9_A    159 --------------------xtavadXGRIIKETANlsdxgvAKLVVFANavednpfxag-------------------- 198  Streptococcus pne...
1H16_A    416 ------------------iaccvspmivgkQMQFFg-ARAN--LAKTmlyainggvdeklkmqvgpksepikgdvlnyde 474  Escherichia coli
1R9E_A    426 --------------rdygiigcvepqkpgkTEGWHdsAFFN--LARIveltinsgfdknkqigpkt---qnfeemksfde 486  Clostridium butyr...
1HK8_A    291 ------------rsflsvwkdstgneildgRNNLGv-VTLN--LPRIaldsyigtq-----------------------f 332  T4
1L1L_A    400 -------------gdvegtnpcgeislangEPCNL--FEVF--PLIAeeq------------------------------ 432  Lactobacillus lei...
4R1R_A    439 ---------cleialptkplndvndengeiALCTL--SAFN--LGAInn------------------------------- 474  Escherichia coli
1XJE_A    317 ----------------nstnpcgeiglsdyEACNL--GSID--VAKFynngf---------------------------- 348  Thermotoga maritima
CAD15248  923 rredahdyacdgcyepqfvganwfhlggvtLLQMLe-VALN--QGRQmqsagpvdlfgknv------------sfrsqpa 987  Ralstonia solanac...
2HA9_A    199 --------------------afhgvgeadvIINVG--VSGPgvVKRAlekvrgq-------------------------- 230  Streptococcus pne...
1H16_A    475 vmermdhFMDWLAKQYITALNIIHYmhdkysyeas-----------------lmalhdrdviRTMACGIA-------GLS 530  Escherichia coli
1R9E_A    487 fmkaykaQMEYFVKHMCCADNCIDIahaeraplpflssmvd-----ncigkgkslqdggaeyNFSGPQGV-------GVA 554  Clostridium butyr...
1HK8_A    333 neqkfveLFNERMDLCFEALMCRISslkgvkatvapilyqegafgvrlkpdddiielfkngrSSVSLGYI-------GIH 405  T4
1L1L_A    433 -----gwDLQEVFALAARYAKRVTFspydweis----------------------reiiqknRRIGISMS-------GIQ 478  Lactobacillus lei...
4R1R_A    475 -----ldELEELAILAVRALDALLDyqdypipa---------------------akrgamgrRTLGIGVI-------NFA 521  Escherichia coli
1XJE_A    349 ---vdleALQELVQIAVRFLDNVIDvnvfpidk---------------------itkavkesRRLGLGIM-------GFA 397  Thermotoga maritima
CAD15248  988 saiasyaELEEVFFKHLEWTFARQMegtv-----------------------------adfgRMEGVCPS-------PLL 1031 Ralstonia solanac...
2HA9_A    231 sfdvvaeTVKKTAFKITRIGQLVGQxaser---------------------------lgvefGIVDLSLAptpavgdSVA 283  Streptococcus pne...
1H16_A    531 VAADSLSaikyakvkpirdedglai--------------------dfeiegeypqfgnndprvDDLAVDLVERFMKKIQK 590  Escherichia coli
1R9E_A    555 NIGDSLVavkkivfdenkitpselkktlnnd--------fknseeiqallknapkfgndidevDNLAREGALVYCREVNK 626  Clostridium butyr...
1HK8_A    406 ELNILVG--------------------------------------------------------RDIGREILTKMNAHLKQ 429  T4
1L1L_A    479 DWLLTRLgnrvvtgfkddfd-------------------------------petheaikvpvyDKRAIKMVDQLYKAVVK 527  Lactobacillus lei...
4R1R_A    522 YYLAKHGkrys------------------------------------------------dgsaNNLTHKTFEAIQYYLLK 553  Escherichia coli
1XJE_A    398 DLLYKLEipyn------------------------------------------------sqeaRDFAANLMAFIALHAHR 429  Thermotoga maritima
CAD15248 1032 NLFIHDClakgrdiyaggarynvfgpcftslantinalwairvmcfdqataittlselvqallCNWGENMIDPLVHPTVL 1111 Ralstonia solanac...
2HA9_A    284 RVLEEXGletvg-----------------------------------------------thgtTAALALLNDQVKKGGVX 316  Streptococcus pne...
1H16_A    591 Lhty--------------------------------------------------------------------------rd 596  Escherichia coli
1R9E_A    627 Ytnp--------------------------------------------------------------------------rg 632  Clostridium butyr...
1HK8_A    430 Wter--------------------------------------------------------------------------tg 435  T4
1L1L_A    528 Adqdysk-------------------------------------------------------------------tlgcne 540  Lactobacillus lei...
4R1R_A    554 Asnelakeqgacpwfnettyakgilpidty---------------------kkdldtianeplhydwealresikthglr 612  Escherichia coli
1XJE_A    430 Tsyelgkekgnfplleisryrtednfv----------------------------pfamgmsnyddeirevmkmtkefrr 481  Thermotoga maritima
CAD15248 1112 Agdatrvsqaatrfrqlrsialslprwgrgnadidrfgneicqrvagiavqvmaqprdgladqyrrkamaygtpahpfgg 1191 Ralstonia solanac...
2HA9_A    317 A------------------------------------------------------------------------------- 317  Streptococcus pne...
1H16_A    597 AIPTQSVLtitsnvvygkkt----gntpdgrragapFGPGANPmhgr--------------------------------- 639  Escherichia coli
1R9E_A    633 GNFQPGLYpssinvyfgslt----gatpdgrksgqpLADGVSPsrgc--------------------------------- 675  Clostridium butyr...
1HK8_A    436 FAFSLYSTpaenlcyrfckldtekygsvkdvtdkgwYTNSFHVsve---------------------------------- 481  T4
1L1L_A    541 SIKHTTVKpsgtv------------------aklagASEGMHFhygayliqrirfqdsdpllpalkacgyrtea------ 596  Lactobacillus lei...
4R1R_A    613 NSTLSALMpsets------------------sqisnATNGIEPprgyvsikaskdgilrqv------------------- 655  Escherichia coli
1XJE_A    482 NVALLTIAptgsi------------------sniadTSSGLEPnfllaytrfvtkedgtkepllyvnqvlreklnpeilk 543  Thermotoga maritima
CAD15248 1192 FCMQPGVGtfasyveqglgc----aasadgrlsgqpLGTDMSPspspldlpatdasqqrvdgvlal-------------- 1253 Ralstonia solanac...
2HA9_A    318 CNQVGGLSg---------------------------AFIPVSEdegxiaa------------------------------ 340  Streptococcus pne...
1H16_A    640 -----------------------------dqkGAVASLTSVAKLpfayakdGISYTFSIVPnalgkd--devrktNLAGL 688  Escherichia coli
1R9E_A    676 -----------------------------dvsGPTAACNSVSKLdhfiasnGTLFNQKFHPsalkg----dnglmNLSSL 722  Clostridium butyr...
1HK8_A    482 -----------------------------eniTPFEKISREAPYhfi-atgGHISYVELPDmkn--------nlkGLEAV 523  T4
1L1L_A    597 --diytenttcvefpikavgadnpnfasagtvSIAEQFATQAFLqtywsdnAVSCTITFQDse----------gdQVESL 664  Lactobacillus lei...
4R1R_A    656 --------------vpdyehlhdayellwempGNDGYLQLVGIMqkf-idqSISANTNYDPsrfpsg---kvpmqQLLKD 717  Escherichia coli
1XJE_A    544 riekeliekgslkdipdvpekikkvfvvaldiDPMDHLLMQDAFqry-vdnNISKTINMPQsat---------vdDVLNV 613  Thermotoga maritima
CAD15248 1254 ---------kgitatdafgfangapvdlnideSIGESRLVEILDafvegagSNILTVTTADqatflaaanspesfDLLRV 1324 Ralstonia solanac...
2HA9_A    341 --------------------------vqngslNLEKLEAXTAICs------VGLDXIAIPEdtp---------aeTIAAX 379  Streptococcus pne...
1H16_A    689 MDGYFhheasieggQHL-NVNV 709  Escherichia coli
1R9E_A    723 IRSYFdq-----kgFHV-QFNV 738  Clostridium butyricum
1HK8_A    524 WDYAAqh------lDYF-GVNM 538  T4
1L1L_A    665 LRQYRfi------tKST-SLLP 679  Lactobacillus leichmannii
4R1R_A    718 LLTAYkf-----gvKTLyYQNT 734  Escherichia coli
1XJE_A    614 YLEALrt-----nvRGI-TVYR 629  Thermotoga maritima
CAD15248 1325 RMGGWtemfvamhaTHQ-KVHP 1345 Ralstonia solanacearum
2HA9_A    380 IADEAaigvinxktTAV-RIIP 400  Streptococcus pneumoniae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap