1CMC,1CMB,1CMA


Conserved Protein Domain Family
Met_repressor_MetJ

?
cd00490: Met_repressor_MetJ 
Click on image for an interactive view with Cn3D
Met Repressor, MetJ. MetJ is a bacterial regulatory protein that uses S-adenosylmethionine (SAM) as a corepressor to regulate the production of Methionine. MetJ binds arrays of two to five adjacent copies of an eight base-pair 'metbox' sequence. MetJ forms sufficiently strong interactions with the sugar-phosphate backbone to accomodate sequence variation in natural operators. However, it is very sensitive to particular base changes in the operator. MetJ exists as a homodimer.
Statistics
?
PSSM-Id: 119402
View PSSM: cd00490
Aligned: 7 rows
Threshold Bit Score: 200.925
Threshold Setting Gi: 114771529
Created: 6-Mar-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
Conserved site includes 13 residues -Click on image for an interactive view with Cn3D
Feature 1:corepressor binding sites
Evidence:
  • Structure:1CMC_A: binds S-adenosylmethionine (SAM), defined using 4.5 A contacts
    View structure with Cn3D
  • Structure:1CMA_A: binds SAM, defined using 4.5 A contacts
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                             #  ##            #  ### ### #  ##         
1CMC_A        1 AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKER 80  Escherichia coli
1CMB_B        1 AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKER 80  Escherichia coli
1CMA_A        1 AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDADLRKER 80  Escherichia coli
1170935       2 ANWDGKYISPYAEHGKKSEQVKKITVSIPIKVLEILTNERTRRQLKSLRHATNSELLCEAFLHAFTGQPLPTDADLMKER 81  Haemophilus infl...
BAC61029      2 ADWNGEYISPYAEHGKKSEQVKKITVSIPLKVLKVLTDERTRRQINNLRHATNSELLCEAFLHAYTGQPLPTDEDLRKDR 81  Vibrio parahaemo...
AAN57031      2 TEWNGEYISPYAEHGKKNEQVKKITVSIPLKVLKVLTDERTRRQVNNLRHATNSELLCEAFLHAYTGQPLPDDADLSKEC 81  Shewanella oneid...
ZP_01448939   2 AQWNGKYIHPYAEHGKKSEQVKKVTVSIPINVLKVLTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPNDNDLKKGN 81  Rhodobacterales ...
Feature 1                              
1CMC_A       81 SDEIPEAAKEIMREMGINPETWE 103 Escherichia coli
1CMB_B       81 SDEIPEAAKEIMREMGINPETWE 103 Escherichia coli
1CMA_A       81 SDEIPEAAKEIMREMGINPETWE 103 Escherichia coli
1170935      82 NDEIPEDAKVLMRELGVDPESWE 104 Haemophilus influenzae
BAC61029     82 PDDIPTEAKALMTAMGIEFEAFD 104 Vibrio parahaemolyticus
AAN57031     82 PDSIPAEAKRLMDEMGIEWEDME 104 Shewanella oneidensis MR-1
ZP_01448939  82 KNRIPESVRQLMEEMGLEAELEA 104 Rhodobacterales bacterium HTCC2255

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap